https://blancostreetscapeproject.org/
Blanco Streetscape Project - The Blanco Streetscape Project
streetscape projectblanco
https://streetscape.ae/
Streetscape International LLC | World Leader in Urban Domain Infrastructure Solutions
Streetscape is a premium provider of solutions for the urban environment. Encompassing urban design solutions, specific street equipment solutions and complete...
world leaderstreetscapeinternationalllcurban
https://archives.cityofsydney.nsw.gov.au/nodes/view/584357
Streetscape with Grand United Building, Castlereagh Street Sydney, 1989 | City of Sydney Archives
Date: Between 1st January 1989 and 31st December 1989 | Series: Central Sydney Heritage Inventory Photographs, 1989-1993 | Unique ID: A-00023712 | Format:...
with grand
https://archives.cityofsydney.nsw.gov.au/nodes/view/673439
Streetscape, Martin Place and George Street Sydney, 1970 | City of Sydney Archives
Date: Between 1st January 1970 and 31st December 1970 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00052398 | Format: Photograph -...
martin placegeorge streetcity ofstreetscape
https://digital.library.illinois.edu/items/f0bd4fb0-38aa-013c-4907-02d0d7bfd6e4-2
Streetscape and urban park in Nairobi, 1971 | Digital Collections at the University of Illinois at...
Color negative showing a scene from a street in the city of Nairobi, including an urban park. From the 1971 Gwendolyn Brooks trip to Africa and England.
https://arch.be.uw.edu/course/south-shore-crossing/streetscape-perspective/
Streetscape Perspective - Architecture
Apr 29, 2026 - Streetscape Perspective
streetscapeperspectivearchitecture
https://archives.cityofsydney.nsw.gov.au/nodes/view/709346
Streetscape, Arthur Street Surry Hills, 2010 | City of Sydney Archives
Date: 26th December 2010 | Series: Mark Stevens Photograph Collection, 2000-2012 | Unique ID: A-00073046 | Format: Photograph - Digital | Read the full record...
city of sydneyarthur streetsurry hillsstreetscapearchives
https://our.wollongong.nsw.gov.au/helensburgh-streetscape-masterplan/widgets/290817/key_dates
Key Dates | Helensburgh Streetscape Masterplan | Let's Talk Wollongong
The draft Streetscape Masterplan expresses the Vision that has been communicated through the Town Centre Planning process, based on community comment received...
key datesstreetscape masterplanhelensburghlettalk
https://archives.cityofsydney.nsw.gov.au/nodes/view/711909
Streetscape, Bellevue Lane Surry Hills, 2011 | City of Sydney Archives
Date: 27th December 2011 | Series: Mark Stevens Photograph Collection, 2000-2012 | Unique ID: A-00074040 | Format: Photograph - Digital | Read the full record...
city of sydneysurry hillsstreetscapebellevuelane
https://archives.cityofsydney.nsw.gov.au/nodes/view/674635
Streetscape and footpath, Elizabeth Street Haymarket, 1973 | City of Sydney Archives
Date: 15th March 1973 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00053363 | Format: Photograph - Negative | Read the full record...
city of sydneyelizabeth streetstreetscapefootpath
https://archives.cityofsydney.nsw.gov.au/nodes/view/680931
Print - Streetscape with Palace Hotel, Flinders Street Darlinghurst, 1916 | City of Sydney Archives
Date: 11th August 1916 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00040645 | Format: Photograph - Print | Read the full record...
https://village-plaza-antioch.paperform.co/
Village Plaza - Antioch Court Streetscape Project
village plazaantiochcourtstreetscapeproject
https://api.streetscapeplus.com/
Login:: Streetscape
streetscape
https://archives.cityofsydney.nsw.gov.au/nodes/view/711902
Streetscape, Albion Way Surry Hills, 2011 | City of Sydney Archives
Date: 27th December 2011 | Series: Mark Stevens Photograph Collection, 2000-2012 | Unique ID: A-00074033 | Format: Photograph - Digital | Read the full record...
city of sydneysurry hillsstreetscapealbionway
https://archives.cityofsydney.nsw.gov.au/nodes/view/673100
Streetscape, South Dowling Street Moore Park, 1970 | City of Sydney Archives
Date: 27th February 1970 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00052103 | Format: Photograph - Negative | Read the full record...
city of sydneymoore parkstreetscapesouthdowling
https://ica-abs.copernicus.org/articles/10/114/2025/
ICA-Abs - Translation of Streetscape in the cities of Taiwan: Renaming the past in Postcolonial...
in the
https://myemail.constantcontact.com/A-Study-for-Western--Streetscape-for-Lawrence--and-Potential-Development.html?soid=1101560283497&aid=64m2OBzVbn8
A Study for Western, Streetscape for Lawrence, and Potential Development
a studywesternstreetscapelawrencepotential
https://myemail.constantcontact.com/Streetscape-Open-House--Leaf-Blower-Ordinance---Derby-Scavenger-Hunt-this-Saturday---and-More-.html?soid=1135561765221&aid=XpUeAt3lv60
Streetscape Open House| Leaf Blower Ordinance | Derby Scavenger Hunt this Saturday | and More!
Email from River Forest News and Information from the Village of River Forest Visit www.vrf.us River Forest Village Board of Trustees Thursday, April 30, 2026...
https://infra.economictimes.indiatimes.com/news/urban-infrastructure/panaji-smart-city-plans-beautification-of-ribandar-with-streetscape-design-plazas-more/90217904
Panaji Smart City plans beautification of Ribandar with streetscape design, plazas & more, ETInfra
IPSCDL said that it has decided to undertake beautification of streets, including streetscape design, landscaping, intersection redesign, plazas, steps, and a...
https://www.nsl.ethz.ch/co-creative-streetscape-transformation-specifying-user-requirements-for-integrated-modeling-and-visualization-tools/
Co-Creative Streetscape Transformation: Specifying User Requirements for Integrated Modelling and...
Mar 4, 2026 - Urban streetscapes need a redesign to meet pressing challenges associated with climate change and environmental degradation. This requires collaboration among...
user requirementsintegrated modellingcocreativestreetscape
https://blogs.ifas.ufl.edu/global/tag/streetscape/
streetscape Archives - What's Happening Around Florida
streetscapearchiveshappeningaroundflorida
https://archives.cityofsydney.nsw.gov.au/nodes/view/678067
Print - Streetscape with Sydney Botanic Gardens, Macquarie Street Sydney, no date | City of Sydney...
Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00039180 | Format: Photograph - Print | Read the full record details for Photograph:...
botanic gardens
https://archives.cityofsydney.nsw.gov.au/nodes/view/584871
Streetscape with houses along Bartley Street Chippendale, 1989 | City of Sydney Archives
Date: Between 1st January 1989 and 31st December 1989 | Series: Central Sydney Heritage Inventory Photographs, 1989-1993 | Unique ID: A-00024226 | Format:...
city of sydney
https://archives.cityofsydney.nsw.gov.au/nodes/view/676951
Print - Streetscape with newsagent and grocery shop, Union Street Pyrmont, 1911 | City of Sydney...
Date: 1st December 1911 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038967 | Format: Photograph - Print | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/666928
Print - Streetscape with Liquor Referendum notice, advertising signs, Riley Street Darlinghurst,...
Date: 10th June 1916 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00037968 | Format: Photograph - Print | Read the full record...
advertising signsprintstreetscapeliquorreferendum
https://archives.cityofsydney.nsw.gov.au/nodes/view/674879
Streetscape with cable laying, corner Elizabeth and Devonshire Streets Surry Hills, 1972 | City of...
Date: 14th December 1972 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00053579 | Format: Photograph - Negative | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/674191
Streetscape, James Street Sydney, 1972 | City of Sydney Archives
Date: 23rd March 1972 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00052981 | Format: Photograph - Negative | Read the full record...
james streetcity ofstreetscapesydneyarchives
https://archives.cityofsydney.nsw.gov.au/nodes/view/674877
Streetscape with cable laying, Terry Street Surry Hills, 1972 | City of Sydney Archives
Date: 14th December 1972 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00053577 | Format: Photograph - Negative | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/680987
Print - Streetscape along Earl Place Potts Point, 1917 | City of Sydney Archives
Date: 10th September 1917 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00040674 | Format: Photograph - Print | Read the full record...
city of sydneypotts point
https://meetings.cityofsydney.nsw.gov.au/ieDecisionDetails.aspx?Id=3567
Decision - Traffic Treatment - Streetscape Improvements - Cope Street, Waterloo
decisiontraffictreatmentstreetscapeimprovements
https://our.wollongong.nsw.gov.au/helensburgh-streetscape-masterplan/widgets/290923/faqs
FAQs | Helensburgh Streetscape Masterplan | Let's Talk Wollongong
The draft Streetscape Masterplan expresses the Vision that has been communicated through the Town Centre Planning process, based on community comment received...
streetscape masterplanfaqshelensburghlettalk
https://archives.cityofsydney.nsw.gov.au/nodes/view/722823
Macleay Reseerve. Proposed streetscape improvements as part of Action Plan No. 2. | City of Sydney...
Date: Between 25th February 1974 and 8th October 1974 | Series: Town Clerk's Department Correspondence Files, 1914-1978 [Municipal Council of Sydney / City of...
https://fast.wistia.net/embed/iframe/ycqx0g1kkt?videoFoam=true
Streetscape Elevations
streetscapeelevations
https://chicagomontreal.blogspot.com/2006/10/rouen-streetscape.html
Chicagoan in Montreal: Rouen Streetscape
One of the pictures I uploaded recently for the European Memoirs blog. Rouen is a very nice city with three impressive gothic churches. A go...
montrealrouenstreetscape
https://archives.cityofsydney.nsw.gov.au/nodes/view/688264
Streetscape, Scott Street Pyrmont, 2009 | City of Sydney Archives
Date: 6th January 2009 | Series: Mark Goddard Photograph Collection, 2007-2009 | Unique ID: A-00061894 | Format: Photograph - Digital | Read the full record...
city of sydneystreetscapescottpyrmontarchives
https://archives.cityofsydney.nsw.gov.au/nodes/view/663574
Print - Streetscape with building targeted for demolition, Liverpool Street Sydney, 1923 | City of...
Date: 31st October 1923 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00037207 | Format: Photograph - Print | Read the full record...
https://realestate.ucsf.edu/content/parnassus-avenue-streetscape-study
Parnassus Avenue Streetscape Study | UCSF Real Estate
parnassusavenuestreetscapestudyucsf
https://archives.cityofsydney.nsw.gov.au/nodes/view/679367
Print - Streetscape Clapton Place Darlinghurst, 1940 | City of Sydney Archives
Date: 15th August 1940 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00039771 | Format: Photograph - Print | Read the full record...
city of sydneyprintstreetscapeclaptonplace
https://breakfastonbikes.blogspot.com/2018/02/new-concepts-and-surveys-out-for-riverfront-park-downtown-streetscape-plans.html
Salem Breakfast on Bikes: New Concepts and Surveys out for Riverfront Park and Streetscape Plans
Both the Riverfront Park and Downtown Streetscape planning processes have released new concepts and new surveys this past week. In one key...
https://archives.cityofsydney.nsw.gov.au/nodes/view/721497
Elizabeth St., between Oxford St. & Gordon St., Paddington. Proposed streetscape improvements as |...
Date: Between 6th November 1973 and 24th April 1975 | Series: Town Clerk's Department Correspondence Files, 1914-1978 [Municipal Council of Sydney / City of...
elizabeth stoxfordgordonpaddingtonproposed
https://ddot.dc.gov/am/page/lower-georgia-avenue-transportation-and-streetscape-improvements
Lower Georgia Avenue Transportation and Streetscape Improvements | ddot
The District Department of Transportation (DDOT) commissioned a detailed study of strategic transportation improvements that could improve multimodal mobility...
lower georgia avenuetransportationstreetscapeimprovementsddot
https://archives.cityofsydney.nsw.gov.au/nodes/view/676204
Print - Streetscape with St Benedicts Church, corner of Wattle and Thomas Streets Ultimo, 1937 |...
Date: 19th October 1937 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038841 | Format: Photograph - Print | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/688590
Streetscape, Quarry Street Ultimo, 2009 | City of Sydney Archives
Date: 17th January 2009 | Series: Mark Goddard Photograph Collection, 2007-2009 | Unique ID: A-00062220 | Format: Photograph - Digital | Read the full record...
city of sydneystreetscapequarryultimoarchives
https://lrs.sog.unc.edu/bill/funds-siler-city-streetscape-project
FUNDS FOR SILER CITY STREETSCAPE PROJECT. | Legislative Reporting Service
siler citystreetscape projectlegislative reportingfundsservice
https://opendata.dc.gov/datasets/new-york-avenue-ne-streetscape-and-trail-study
New York Avenue NE Streetscape and Trail Study
In 2022-24 DDOT completed a study of the New York Avenue NE corridor to evaluate streetscape and trail imporvements.
new yorkavenuestreetscapetrailstudy
https://archives.cityofsydney.nsw.gov.au/nodes/view/666058
Streetscape, Kent Street Sydney, 1965 | City of Sydney Archives
Date: 1st September 1965 | Series: City Engineer's Photographic Negatives, 1953-1975 | Unique ID: A-00046690 | Format: Photograph - Negative | Read the full...
kent streetcity ofstreetscapesydneyarchives
https://clevelandpark-streetscape.ddot.dc.gov/items/c8c8623a6eec49c59df55f4235d7a8b3
Cleveland Park Streetscape
The Cleveland Park Streetscape and Drainage Improvement Project along Connecticut Avenue from Macomb Street NW to Quebec Street NW is located in Ward 3,...
cleveland parkstreetscape
https://haveyoursay.waverley.nsw.gov.au/curlewisstreetscape
Curlewis St Streetscape Upgrade | Have Your Say Waverley
We're upgrading Curlewis Street in Bondi Beach to make it safer for pedestrians and bike riders.
have your saycurlewisstupgradewaverley
https://ceqanet.lci.ca.gov/2024031034/5
*Withdrawn Per Lead Request* Broadway Streetscape Improvements
2024031034 - 2024-03-28 - NOE - *Withdrawn Per Lead Request* Broadway Streetscape Improvements
withdrawnperleadrequestbroadway
https://archives.cityofsydney.nsw.gov.au/nodes/view/709043
Streetscape, Raper Street Surry Hills, 2010 | City of Sydney Archives
Date: 31st October 2010 | Series: Mark Stevens Photograph Collection, 2000-2012 | Unique ID: A-00072869 | Format: Photograph - Digital | Read the full record...
city of sydneysurry hillsstreetscaperaperarchives
https://www.streetscapemgmt.com/
Home | Streetscape Management
Hello, we are Streetscape Management! Since 2008, we have been the trusted name in commercial and residential landscaping, lighting, and patios/pavers...
streetscapemanagement
https://app.streetscape.ai/
Login:: Streetscape
streetscape
https://ourstory.randwick.nsw.gov.au/nodes/view/4714
Streetscape in Randwick Barracks | Randwick City Council
Date: June 2002 | Source: Randwick City Council | Read the full record details for Images: Streetscape in Randwick Barracks
streetscaperandwickbarrackscitycouncil
https://archives.cityofsydney.nsw.gov.au/nodes/view/666703
Print - Streetscape of William Street near Cook and Phillip Park Sydney, 1916 | City of Sydney...
Date: Between 1st January 1916 and 31st December 1916 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00037947 | Format: Photograph -...
https://archives.cityofsydney.nsw.gov.au/nodes/view/673373
Streetscape, William Street Darlinghurst and Woolloomooloo, 1970 | City of Sydney Archives
Date: 31st July 1970 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00052338 | Format: Photograph - Negative | Read the full record details...
city of sydneywilliam streetstreetscapedarlinghurst
https://archives.cityofsydney.nsw.gov.au/nodes/view/673133
Streetscape and footpath, Palmer Street Woolloomooloo, 1970 | City of Sydney Archives
Date: 26th March 1970 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00052132 | Format: Photograph - Negative | Read the full record...
city of sydneystreetscapefootpathpalmer
https://archives.cityofsydney.nsw.gov.au/nodes/view/721108
Action Plan No. 2 (Design of streetscape improvements & street furniture - stage 2). Clarke | City...
Date: Between 16th May 1972 and 12th December 1972 | Series: Town Clerk's Department Correspondence Files, 1914-1978 [Municipal Council of Sydney / City of...
https://lrs.sog.unc.edu/lrs-subscr-view/bills_summaries/558913/S341
Bill Summaries: S341 FUNDS FOR SILER CITY STREETSCAPE PROJECT. | Legislative Reporting Service
bill summariessiler city
https://archives.cityofsydney.nsw.gov.au/nodes/view/711252
Streetscape, Fitzroy Place Surry Hills, 2011 | City of Sydney Archives
Date: 4th December 2011 | Series: Mark Stevens Photograph Collection, 2000-2012 | Unique ID: A-00073758 | Format: Photograph - Digital | Read the full record...
city of sydneysurry hillsstreetscapefitzroyplace
https://archives.cityofsydney.nsw.gov.au/nodes/view/677307
Print - Streetscape with buildings along George Street West Camperdown, 1911 | City of Sydney...
Date: 1st December 1911 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00039043 | Format: Photograph - Print | Read the full record...
https://ceqanet.lci.ca.gov/2016072030
Meadowview Road and 24th Street Streetscape Improvements Project
2016072030 - 2016-07-13 - MND - Meadowview Road and 24th Street Streetscape Improvements Project
meadowviewroadstreetimprovementsproject
https://archives.cityofsydney.nsw.gov.au/nodes/view/674485
Streetscape and road condition, Market Street Sydney, 1972 | City of Sydney Archives
Date: 18th August 1972 | Series: City Engineer's Photographs II, 1967-1973 | Unique ID: A-00053237 | Format: Photograph - Negative | Read the full record...
road conditionmarket streetcity ofstreetscape
https://floridaavene-streetscape.ddot.dc.gov/items/602ed4c64c624f8ab075949adbc296fc
Florida Ave NE Streetscape
The Florida Avenue NE Streetscape project (2nd to H Street NE) supports DC's Vision Zero initiative and represents opportunities to improve safety for all...
floridaavenestreetscape
https://archives.cityofsydney.nsw.gov.au/nodes/view/676624
Print - Streetscape with houses on Duke Street Woolloomooloo, 1912 | City of Sydney Archives
Date: 16th July 1912 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038899 | Format: Photograph - Print | Read the full record...
https://cran.ma.imperial.ac.uk/web/packages/streetscape/index.html
CRAN: Package streetscape
cranpackagestreetscape
https://scholarspace.manoa.hawaii.edu/items/5bad9d1b-4df9-4ee3-91b4-0676aa064a75
Ala Moana Boulevard Redefining the Edge: Redefining the Urban Streetscape to Account for New and...
There are currently multiple layers of development that define the existing urban conditions surrounding and relating to Ala Moana Boulevard. Initial...
https://survey123.arcgis.com/share/1cb041490ef9475db910509e1386cfb1
I-375 Reconnecting Communities Project Streetscape Aesthetics Survey
reconnecting communitiesprojectstreetscapeaestheticssurvey
https://archives.cityofsydney.nsw.gov.au/nodes/view/676758
Print - Streetscape with houses, Duke Street Woolloomooloo, 1912 | City of Sydney Archives
Date: 16th July 1912 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038921 | Format: Photograph - Print | Read the full record...
city of sydneyduke street
https://archives.cityofsydney.nsw.gov.au/nodes/view/688557
Streetscape, corner of Fig Lane and Henry Avenue Ultimo, 2009 | City of Sydney Archives
Date: 17th January 2009 | Series: Mark Goddard Photograph Collection, 2007-2009 | Unique ID: A-00062187 | Format: Photograph - Digital | Read the full record...
https://georgewbush-whitehouse.archives.gov/omb/kn20drgh/by-agency/agency_title/bureau_title/account_title/earmarks/earmark_182472.html
Earmark - To the City of Bernardsville, New Jersey for the downtown streetscape project
to the city
https://digitalcollections.udel.edu/Documents/Detail/frederica-streetscape/56809
Frederica Streetscape - University of Delaware Digital Collections
university of delawarefredericastreetscapedigitalcollections
https://our.wollongong.nsw.gov.au/helensburgh-streetscape-masterplan-project-update?tool=news_feed
Helensburgh Streetscape Masterplan - Project Update | Let's Talk Wollongong
We spoke with the community in 2019 and 2020 to develop the Helensburgh Town Centre Plan and the Streetscape Masterplan. We've completed Stage 1 works, are...
streetscape masterplanproject updatehelensburghlettalk
https://archives.cityofsydney.nsw.gov.au/nodes/view/584230
Streetscape with buildings and terrace houses, Kent Street Millers Point, 1989 | City of Sydney...
Date: Between 1st January 1989 and 31st December 1989 | Series: Central Sydney Heritage Inventory Photographs, 1989-1993 | Unique ID: A-00023585 | Format:...
https://archives.cityofsydney.nsw.gov.au/nodes/view/675963
Print - Streetscape with terrace houses on Macquarie Street Sydney, 1933 | City of Sydney Archives
Date: 11th January 1933 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038818 | Format: Photograph - Print | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/693915
Woolloomooloo Redevelopment Project, streetscape, Rae Place Woolloomooloo, 1977 | City of Sydney...
Date: Between 1st June 1977 and 30th June 1977 | Series: Woolloomooloo Redevelopment Project Photographs, 1960-2003 | Unique ID: A-00067545 | Format:...
redevelopment projectcity ofwoolloomooloostreetscaperae
https://ceqanet.lci.ca.gov/2026041218
Old Town Newark Streetscape - Water Main Replacement
2026041218 - 2026-04-27 - NOE - Old Town Newark Streetscape - Water Main Replacement
old townwater mainnewarkstreetscapereplacement
https://seattle-daily-photo.blogspot.com/2006/07/colorful-streetscape-in-wallingford.html?showComment=1153305720000
Seattle Daily Photo: Colorful Streetscape in U District
I came across this scene in the U District. The warm afternoon summer sun invited me to photograph this wall. Seattle has a very lively visu...
daily photoseattlecolorfulstreetscapedistrict
https://historyhub.ryde.nsw.gov.au/nodes/view/7171
Streetscape of Rowe Street, Eastwood, 18 May 1965 | Ryde History Hub
Date Taken: 18 May 1965 | Type: Photograph | Read the full record details for Image: Streetscape of Rowe Street, Eastwood, 18 May 1965
streetscaperoweeastwood
https://archives.cityofsydney.nsw.gov.au/nodes/view/584829
Streetscape with Argyle Cut, Argyle Street The Rocks Sydney, 1989 | City of Sydney Archives
Date: Between 1st January 1989 and 31st December 1989 | Series: Central Sydney Heritage Inventory Photographs, 1989-1993 | Unique ID: A-00024184 | Format:...
the rocks sydney
https://our.wollongong.nsw.gov.au/helensburgh-streetscape-masterplan-stage-2
Helensburgh Streetscape Masterplan Stage 2 | Let's Talk Wollongong
Following extensive community engagement in 2019 and 2020 the Helensburgh Town Centre Plan and the Streetscape Masterplan were adopted by Council on 26 October...
streetscape masterplanhelensburghstagelettalk
https://housingandcommunityregeneration.nd.edu/research-category/street-design/streetscape-features/
Streetscape Features Archives | Housing & Community Regeneration Initiative | University of Notre...
features archivescommunity regenerationuniversity ofstreetscapehousing
https://archives.cityofsydney.nsw.gov.au/nodes/view/664343
Streetscape, Rowe Street Sydney, 1964 | City of Sydney Archives
Date: 13th February 1964 | Series: City Engineer's Photographic Negatives, 1953-1975 | Unique ID: A-00046182 | Format: Photograph - Negative | Read the full...
city ofstreetscaperowesydneyarchives
https://hg.gatech.edu/node/674989
UPDATE: East Campus Streetscape Project Makes Steady Progress | Mercury
UPDATE: The Georgia Department of Transportation (GDOT) approved the permit for the East Campus Streetscapes project to activate at the corners of Techwood...
east campusstreetscape projectsteady progressupdatemakes
https://archives.cityofsydney.nsw.gov.au/nodes/view/1949359
Streetscape, George Street Haymarket, 1986 | City of Sydney Archives
Date: Between 1st January 1986 and 31st December 1986 | Series: Alan Dunstan Photograph Collection, 1964-2008 | Unique ID: A-01184732 | Format: Photograph -...
city of sydneygeorge streetstreetscapehaymarketarchives
https://archives.cityofsydney.nsw.gov.au/nodes/view/667222
Print - Streetscape, William Street and Barnett Lane Darlinghurst, 1916 | City of Sydney Archives
Date: 19th June 1916 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00038005 | Format: Photograph - Print | Read the full record...
https://archives.cityofsydney.nsw.gov.au/nodes/view/693555
Woolloomooloo Redevelopment Project, south view, streetscape, Brougham Street Woolloomooloo, 1970 |...
Date: Between 1st January 1970 and 31st December 1979 | Series: Woolloomooloo Redevelopment Project Photographs, 1960-2003 | Unique ID: A-00067185 | Format:...
redevelopment projectsouth viewwoolloomooloostreetscapebrougham
https://floridaavene-streetscape.ddot.dc.gov/items/2ed5452061794f1ab1bc13d72de8014f
Florida Ave NE Streetscape
The Florida Avenue NE Streetscape project (2nd to H Street NE) supports DC's Vision Zero initiative and represents opportunities to improve safety for all...
floridaavenestreetscape
https://our.wollongong.nsw.gov.au/warrawong-streetscape-upgrade/widgets/351033/documents
The Plans | Warrawong Streetscape Upgrade | Let's Talk Wollongong
To translate this page, select your language from the drop-down box in the top left-hand corner of the webpage. Council has listened to the Warrawong...
the planswarrawongstreetscapeupgradelet
https://seattle-daily-photo.blogspot.com/2006/07/colorful-streetscape-in-wallingford.html?showComment=1153320720000
Seattle Daily Photo: Colorful Streetscape in U District
I came across this scene in the U District. The warm afternoon summer sun invited me to photograph this wall. Seattle has a very lively visu...
daily photoseattlecolorfulstreetscapedistrict
https://archives.cityofsydney.nsw.gov.au/nodes/view/674523
Streetscape, Flinders Street Sydney, 1986 | City of Sydney Archives
Date: 31st May 1986 | Series: Photographs of Monuments, Foundation Stones, Plaques, Buildings and Streetscapes, 1986 | Unique ID: A-00058436 | Format:...
flinders streetcity ofstreetscapesydneyarchives
https://connave-streetscape.ddot.dc.gov/datasets
Connecticut Ave Streetscape and Deckover
This project will enhance the quality of life for residents and sustain the environment, while increasing safety through planning and engineering solutions in...
connecticutavestreetscapedeckover
https://bradanick.blogspot.com/2014/04/14057-orillia-opp-ghq-streetscape-blinds.html
Bradanick Construction Services: 14057 - Orillia OPP GHQ Streetscape Blinds
Bradanick Construction Services Inc. has confirmed its intentions to bid on the following project. Project Reference: 14057 - Orillia OP...
construction servicesorilliaoppghqstreetscape
https://opendata.dc.gov/datasets/florida-ave-ne-streetscape
Florida Ave NE Streetscape
The Florida Avenue NE Streetscape project (2nd to H Street NE) supports DC's Vision Zero initiative and represents opportunities to improve safety for all...
floridaavenestreetscape
https://archives.cityofsydney.nsw.gov.au/nodes/view/663792
Print - Streetscape with houses for demolition, Princes Street Millers Point, 1926 | City of Sydney...
Date: 3rd December 1926 | Series: Demolition Books - Albums and Prints, 1900-1949 | Unique ID: A-00037425 | Format: Photograph - Print | Read the full record...
https://downtownforeveryone.com/
Downtown for Everyone. City of Bloomington Streetscape + Square Design Project - Bloomington,...
city of bloomingtonfor everyonesquare designdowntownstreetscape
https://our.wollongong.nsw.gov.au/helensburgh-streetscape-masterplan-stage-2/widgets/325838/documents
Paving Options | Helensburgh Streetscape Masterplan Stage 2 | Let's Talk Wollongong
Following extensive community engagement in 2019 and 2020 the Helensburgh Town Centre Plan and the Streetscape Masterplan were adopted by Council on 26 October...
streetscape masterplanpavingoptionshelensburgh
https://seattle-daily-photo.blogspot.com/2006/07/colorful-streetscape-in-wallingford.html?showComment=1153315500000
Seattle Daily Photo: Colorful Streetscape in U District
I came across this scene in the U District. The warm afternoon summer sun invited me to photograph this wall. Seattle has a very lively visu...
daily photoseattlecolorfulstreetscapedistrict
https://haveyoursay.waverley.nsw.gov.au/Charingcross
Charing Cross Streetscape Upgrade | Have Your Say Waverley
We're upgrading the Charing Cross business precinct!
have your saycharing crossstreetscapeupgradewaverley
https://ourstory.randwick.nsw.gov.au/nodes/view/4487
Avoca Street streetscape | Randwick City Council
Date: 1986 | Source: Randwick City Library | Read the full record details for Images: Avoca Street streetscape
avocastreetrandwickcitycouncil
https://archives.cityofsydney.nsw.gov.au/nodes/view/719461
Street furniture & low cost streetscape improvements. Submission of design standards etc., by joint...
Date: Between 4th December 1970 and 20th July 1978 | Series: Town Clerk's Department Correspondence Files, 1914-1978 [Municipal Council of Sydney / City of...