https://www.22miles.com/
22Miles Award-Winning Digital Signage & Wayfinding Solutions
Feb 9, 2026 - Explore 22Miles flexible and scalable digital signage, wayfinding, video wall, and AI solutions. Book a demo today!
award winningdigital signagewayfindingsolutions
https://acquiredigital.com/
Acquire Digital | Digital wayfinding, Interactive kiosk & digital signage experiences.
Discover Acquire Digital's innovative solutions in digital signage, interactive kiosks, and wayfinding systems. With over 25 years of experience and 25,000+...
acquire digitalinteractive kioskwayfindingsignageexperiences
https://dnco.com/
DNCO | The world's leading place branding and wayfinding consultancy
A global team of experts specialising in place branding and wayfinding based in London and New York. We work across six disciplines: strategy, branding,...
the worldplace brandingdncoleadingwayfinding
https://herva.be/home
Herva-Doublet | Straatmeubilair, Gevelaankleding & Wayfinding
Herva versterkt je merk met straatmeubilair, gevelaankleding, wayfinding en interieur. Duurzame oplossingen die zichtbaarheid en beleving verhogen.
hervadoubletstraatmeubilairgevelaankledingwayfinding
https://environmentalbranddesign.com/
Environmental Design, Architectural signage, Wayfinding, Wall graphics
Jun 25, 2025 - OW|EN is a creative studio specializing in architectural signage, environmental design, wayfinding, branded wall graphics, and much more
environmental designarchitectural signagewayfindingwallgraphics
https://diadem.co/
Signage Design & Wayfinding: Enhancing User Experience
Jun 23, 2026 - Find out how Diadem delivers innovative, sustainable, and practical solutions by integrating services and sectors effectively.
signage designwayfindingenhancinguserexperience
https://qbarriers.co.uk/
Q Barriers UK | Belt Barriers, Wayfinding & Smart Queue Specialists
Apr 2, 2026 - Europe’s no.1 supplier of belt barriers, partition walls and smart queue solutions. Q help airports, retail and more improve queues, wayfinding and customer...
smart queuebarriersukbeltwayfinding
https://viadirect.com/
ViaDirect • Digital Wayfinding & Signage Solutions
Jul 14, 2026 - We support you in the digital transformation of your public space with wayfinding and digital signage solutions.
digital wayfindingsignagesolutions
https://spacewizard.pl/
Space Wizard – space branding – wayfinding – oznakowanie – projekty dla biur, grafiki do biura,...
space wizard
https://transferhero.app/
TransferHero — DC Metro wayfinding
DC Metro wayfinding with real-time arrivals
dc metrowayfinding
https://burovanbaar.nl/
Buro Van Baar | Graphic design Wayfinding design editorial design & book productions
graphic designburovanbaarwayfinding
https://www.cygnus.group/
Wayfinding & Signage Design | Cygnus Design Group
Cygnus Design Group is a strategic multidisciplinary consultancy specializing in wayfinding, signage standards, and branded environments.
wayfinding signagedesigncygnusgroup
https://enviropop.com/
Wayfinding & Branded Signage Experts | Enviropop
Jun 4, 2025 - Enviropop's end-to-end services include wayfinding design, environmental branding, and monument signage. Discover our process and work.
branded signagewayfindingexperts
https://www.climatewayfinding.earth/
Climate Wayfinding
climatewayfinding
https://www.interactivewayfinding.com/
Interactive Wayfinding at The Music Center
interactive wayfindingat themusiccenter
https://books.google.com.au/books?id=QLHgCAAAQBAJ&printsec=frontcover&source=gbs_book_other_versions_r&cad=2
Signage and Wayfinding Design: A Complete Guide to Creating Environmental ... - Chris Calori, David...
A new edition of the market-leading guide to signage and wayfinding design This new edition of Signage and Wayfinding Design: A Complete Guide to Creating...
signage and wayfinding
https://www.weareendpoint.com/
Wayfinding, Signage Design & Creative Placemaking - Endpoint
wayfinding signagedesign creativeplacemakingendpoint
https://waypointsignco.com/
Home - Waypoint Sign Company - Wayfinding, Code and ADA Signage
sign companywaypointwayfindingcodeada
https://www.cityofsydney.nsw.gov.au/strategies-action-plans/wayfinding-strategy
City of Sydney wayfinding strategy - City of Sydney
The strategy provides a guiding document to inform future design development and project implementation for the City's pedestrian wayfinding system.
city of sydneywayfindingstrategy
https://dac.berkeley.edu/wayfinding
Wayfinding | Disability Access & Compliance
disability accesswayfindingcompliance
https://discover.signagent.com/the-wayfinding-system-checkup
The Wayfinding System Checkup
Our free Wayfinding System Checkup will help you identify opportunities to reduce friction, control costs, and improve visitor experience.
wayfinding systemcheckup
https://www.ucl.ac.uk/bartlett/events/2019/dec/social-wayfinding-prof-ruth-dalton-university-lancaster
Social Wayfinding by Prof Ruth Dalton of the University of Lancaster | UCL Bartlett Faculty of the...
https://www.astrographic.com/
Astrographic Industries Surrey | Print | Signage | Traffic | Wayfinding
Jan 8, 2021 - Astrographic Ind. is working with a multitude of customers ranging from large government sectors to small local businesses. We are leading provider of custom...
print signageindustriessurreytrafficwayfinding
https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/59452
When in doubt follow your nose a wayfinding strategy
follow your nosein doubtwayfindingstrategy
https://maps.ubc.ca/?locat1=402
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://www.agx.in/
Retail Branding | Space Design | Wayfinding | AGX
Mar 22, 2024 - AGX specializes in retail branding, space design, and wayfinding solutions to elevate your store environment and customer experience.
retail brandingspace designwayfindingagx
https://www.dsignmarking.nl/nl
DsignMarking | Signing & Wayfinding voor bedrijven
Al 40 jaar maken we branding, signing en wayfinding helder, binnen én buiten.
signingwayfindingvoorbedrijven
https://stevesheppardmusicreviews.blogspot.com/2021/05/wayfinding-by-christof-r-davis.html
Steve Sheppard Music Reviews: Wayfinding By Christof R Davis
Steve Sheppard Music Reviews, reviews written for musicians by Steve Sheppard
music reviewsstevesheppardwayfindingchristof
https://insights.ges.com/client-stories/imts-creative-wayfinding
IMTS - Creative Wayfinding
Discover how IMTS improved attendee navigation at McCormick Place with a creative wayfinding system, enhancing engagement and streamlining the experience for...
imtscreativewayfinding
https://repository.arizona.edu/handle/10150/680014
Qualitative wayfinding: Dissertation reflections on poststructural analysis of academic library...
qualitativewayfindingdissertationreflectionsanalysis
https://eg-projector.en.made-in-china.com/product/AJkpwcObrMrF/China-Public-Restroom-Guidance-Wayfinding-Warning-Signs-LED-Gobo-Projection-Light.html
Public Restroom Guidance Wayfinding Warning Signs LED Gobo Projection Light - Gobo Light and Logo...
Public Restroom Guidance Wayfinding Warning Signs LED Gobo Projection Light, Find Details and Price about Gobo Light Logo Light from Public Restroom Guidance...
public restroomwarning signs
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=n&locat1=028&locat2
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://events.la.psu.edu/event/wayfinding_wednesdays_what_scholarships_or_funding_are_available_5550/
Wayfinding Wednesdays: What scholarships or funding are available? | Liberal Arts Events
Jan 18, 2024 - Drop by the Chaiken Center for Student Success to chat with a student support staff member and learn about a resource or opportunity that could help you...
are availableliberal artswayfindingwednesdaysscholarships
https://grandecampus.way.wf/
Wayfinding
wayfinding
https://access-wmt.co.uk/
BSL Wayfinding for West Midlands Trains
The home page for the project to include customer support in BSL for Deaf passengers on West Midlands Trains.
west midlandsbslwayfindingtrains
https://rossifilippo.it/
Filippo Rossi Graphic Information & Wayfinding Design
Graphic Information designer, specializzato in Wayfinding, Mappe e illustrazioni con base a Terni, Umbria
filippo rossigraphic informationwayfindingdesign
https://www.cbsnews.com/pittsburgh/news/pittsburgh-pedestrian-wayfinding-system/
New pedestrian wayfinding system unveiled in Pittsburgh - CBS Pittsburgh
More than 30 street map kiosks and nearly 100 signs will be installed throughout the city to help those walking through town find their way.
wayfinding systemnewpedestrianunveiledpittsburgh
https://map.nipissingu.ca/
Nipissing University :: Campus Tours & Wayfinding
nipissing universitycampus tourswayfinding
https://business.fsu.edu/about-us/wayfinding-maps
Wayfinding Maps | Herbert Wertheim College of Business
Click on the images below to view each map at full size.
wayfinding mapscollege ofherbertwertheimbusiness
https://www.aci.uk.net/office-wayfinding-what-is-it-and-how-can-it-improve-your-workplace/
Office wayfinding: what is it and how can it improve your workplace? - ACI
Jul 24, 2025 - Discover the benefits of office wayfinding and how it can improve navigation, safety, and branding in your workplace.
what is itimprove your workplaceoffice wayfinding
https://books.google.com.au/books?id=QLHgCAAAQBAJ&source=gbs_book_other_versions_r&cad=2
Signage and Wayfinding Design: A Complete Guide to Creating Environmental ... - Chris Calori, David...
A new edition of the market-leading guide to signage and wayfinding design This new edition of Signage and Wayfinding Design: A Complete Guide to Creating...
signage and wayfinding
https://www.flyinggeesepro.nz/
Flying Geese - Ancient Wayfinding For Modern Challenges
We are Flying Geese, a V-formation of leaders and facilitators who use an ancient model to help organisations navigate their greatest challenges.
flying geeseancientwayfindingmodernchallenges
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=n&locat1=130&locat2=
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=&locat1=386
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://sw.airbnb.com/rooms/1427024234728602874
The Wayfinding Ranch House - Nyumba ya Kupangisha katika Elizabeth, Colorado, Marekani - Airbnb
The Wayfinding Ranch House
ranch house
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=n&locat1=166
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://www.mapspeople.com/
MapsPeople - Custom Indoor Mapping & Wayfinding Software
Give your smart building product the best indoor map experience on the market. We build the maps, you grow the business.
indoor mappingcustomwayfindingsoftware
https://brandculture.com.au/
BrandCulture — Branding, Environments and Wayfinding
We are an award-winning design studio based in Sydney. We specialise in strategic design-led wayfinding, signage, environmental graphics and branding.
brandingenvironmentswayfinding
https://maps.ubc.ca/?code=FBIC
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://wayfinding.guide/
Walking and Wayfinding in the Westfjords of Iceland
May 28, 2025 - A decade of walking and wayfinding through the Westfjords weaving together the practical and the ethereal to guide you on your way.
in thewalkingwayfindingwestfjordsiceland
https://3dwayfinder.com/
Indoor positioning and wayfinding | 3D Wayfinder
Indoor navigation and wayfinding software and service provider for shopping centers, airports, train stations, etc. Kiosks, mobile and web application.
indoor positioningwayfindingwayfinder
https://wisenav.co.nz/
WiseNav | Digital Wayfinding with Streamlined Navigation
Apr 24, 2024 - Achieve precise indoor and outdoor navigation with WiseNav's digital wayfinding expertise. Superior, swift, and cost-effective solutions!
digital wayfindingstreamlinednavigation
https://maps.ubc.ca/?locat1=52
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://mtc.ca.gov/news/mapping-wayfinding
Mapping & Wayfinding | Metropolitan Transportation Commission
mappingwayfindingmetropolitantransportationcommission
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=&locat1=774
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://ftyview.en.made-in-china.com/product/PrHpYoKCbJVX/China-43-55-Inch-Floor-Standing-Dynamic-Full-HD-1080P-LCD-Wayfinding-Digital-Signage-Screen-Totem-Display.html
43 55 Inch Floor Standing Dynamic Full HD 1080P LCD Wayfinding Digital Signage Screen Totem Display...
43 55 Inch Floor Standing Dynamic Full HD 1080P LCD Wayfinding Digital Signage Screen Totem Display, Find Details and Price about Digital Signage LCD Display...
https://es.mtc.ca.gov/digital-library/5075018-3aii-24-0132-ppt-regional-mapping-and-wayfinding-project-update
3aii 24 0132 PPT Regional Mapping and Wayfinding Project Update | Metropolitan Transportation...
MTC is the Metropolitan Transportation Commission. We are a public, governmental agency responsible for planning, financing and coordinating transportation for...
regional mapping
https://en.marcal.fr/
Marcal sign system manufactures architectural sign and graphic design for wayfinding solution
Marcal sign system manufactures high quality architectural wayfinding solution. Exterior sign system, interior sign system, fire safety sign, tactile floor,...
sign systemgraphic designmarcalmanufacturesarchitectural
https://maps.ubc.ca/?show=y,y,y,y,y,y&bldg2Search=n&locat1=N045&locat2=
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://www.wishesandwayfinding.com/
Disney Newsletter | Wishes & Wayfinding
disneynewsletterwisheswayfinding
https://zhview.en.made-in-china.com/product/pmDYXtNGJqVi/China-55-Inch-Capacitive-Touch-Screen-Floor-Stand-Wayfinding-Outdoor-Digital-Signage-Display-Panels.html
55 Inch Capacitive Touch Screen Floor Stand Wayfinding Outdoor Digital Signage Display Panels -...
55 Inch Capacitive Touch Screen Floor Stand Wayfinding Outdoor Digital Signage Display Panels, Find Details and Price about Outdoor Digital Signage Display...
capacitive touch screen
https://maps.ubc.ca/?locat1=478
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=n&locat1=308
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://events.la.psu.edu/event/cc-ww_031523/
Wayfinding Wednesday: Academic Scholarships | Liberal Arts Events
Jan 18, 2024 - Staci Kelly, student awards coordinator for the College of the Liberal Arts, will be in the Chaiken Center to answer your questions about scholarships and how...
academic scholarshipsliberal artswayfindingwednesdayevents
https://insights.samsung.com/tag/wayfinding/
wayfinding Archives - Samsung Business Insights
samsung businesswayfindingarchivesinsights
https://repository.law.upenn.edu/Documents/Detail/getting-from-points-a-to-points-b-wayfinding-public-accommodations-and-the-ada/142922
Getting from Points A to Points B: Wayfinding, Public Accommodations, and the ADA - Intellectual...
Getting from Points A to Points B: Wayfinding, Public Accommodations, and the ADA, David Ferleger, Essay, University of Pennsylvania Law Review Online, 170 U....
a to b
https://manoa.hawaii.edu/exploringourfluidearth/physical/navigation-and-transportation/wayfinding-and-navigation/question-set-wayfinding-and-navigation
Question Set: Wayfinding and Navigation | manoa.hawaii.edu/ExploringOurFluidEarth
questionsetwayfindingnavigationmanoa
https://adacentral.com/
ADA Central Signs - ADA Signs, Signage, Wayfinding, & More
adacentralsignssignagewayfinding
https://aats.today/
Enhancing Indoor Wayfinding for Everyone
Discover how our innovative solutions improve indoor wayfinding, ensuring accessibility and seamless navigation for individuals with disabilities.
indoor wayfindingenhancingeveryone
https://www.bestsignsinc.com/
Custom Signs Sign Design Wayfinding Signage Systems Consultants Palm Springs CA
Best Signs Inc. provides custom signs, sign design and wayfinding signage systems for businesses and government entities. Located in Palm Springs, CA.
custom signswayfinding signagepalm springsdesign
https://it.mathworks.com/matlabcentral/cody/problems/2226-wayfinding-4-crossing-level-2
Wayfinding 4 - Crossing, level 2 - MATLAB Cody - MATLAB Central
wayfindingcrossinglevelmatlabcody
https://form.jotform.com/80364308984161
Apply for a Wayfinding Journey!
Please click the link to complete this form.
apply for awayfindingjourney
https://pure.psu.edu/en/publications/evaluation-of-wayfinding-aids-in-virtual-environment/
Evaluation of wayfinding aids in virtual environment - Penn State
virtual environmentevaluationwayfindingaidspenn
https://mtc.ca.gov/digital-library/5105881-3aii-24-0132-ppt-regional-mapping-and-wayfinding-project-update
3aii 24 0132 PPT Regional Mapping and Wayfinding Project Update | Metropolitan Transportation...
MTC is the Metropolitan Transportation Commission. We are a public, governmental agency responsible for planning, financing and coordinating transportation for...
regional mapping
https://huntdesign.com/
Hunt Design - Wayfinding, Signage, and Exhibit Design Specialists
Dec 16, 2025 - Hunt Design creates engaging visitor experiences. Hunt Design is a graphic design consulting firm specializing in environmental graphics, wayfinding design,...
wayfinding signagehuntdesignexhibitspecialists
https://www.fournir.co/
Fournir - experiential graphic design, wayfinding, brand development
Daren Guillory is a multi-disciplinary designer and illustrator who uses design thinking and problem solving to produce compelling brand experiences.
experiential graphic designfournirwayfindingbranddevelopment
https://uwaterloo.ca/indigenous/welcome/indigenous-wayfinding-report-2024
Indigenous Wayfinding Report 2024 | Office of Indigenous Relations | University of Waterloo
Learn more about the Indigenous Wayfinding Initiative at UWaterloo
office ofindigenouswayfindingreportrelations
https://katalog.bibliothek.kit.edu/bib/359924
Details for: Wayfinding : an interdisciplinary journey into the domain of spatial representation in...
OPAC der KIT-Bibliothek
https://www.signalisatie.tech/nl/
start - Signalisatie by Neopaul wayfinding, signalisatie, people flow, info
Jul 31, 2023 - Neopaul maak je site overzichtelijk voor je klanten zodat je bezoekers makkelijk de weg vinden. Brengt je informatie op unieke manier.
people flowstartsignalisatiewayfindinginfo
https://uk.mathworks.com/matlabcentral/cody/problems/2220-wayfinding-3-passed-areas
Wayfinding 3 - passed areas - MATLAB Cody - MATLAB Central
wayfindingpassedareasmatlabcody
https://byhaus.ca/fr/
by_Haus - by_Haus studio. branding. brand. identité. identity. signalétique. wayfinding. design...
byHAUS est le studio de Philippe Archontakis et de Martin Laliberté, deux designers graphiques agréés, établis à Montréal. Le studio se spécialise dans la...
studio brandinghausidentitywayfindingdesign
https://advertiseme.com.au/
Digital Solutions Provider - Advertise Me - Digital Signage | Digital Wayfinding | Social Wall |...
Jun 10, 2026 - Advertise Me is a digital solutions hardware and software company focusing on all aspects of Digital Signage, Digital Wayfinding, Social Wall, Video Wall,...
digital solutionsadvertise meprovidersignagewayfinding
https://maps.ubc.ca/?locat1=529
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://blogs.ubc.ca/courtneyc/tag/wayfinding-ubc/
Wayfinding UBC |
wayfindingubc
https://www.researchandmarkets.com/reports/5598087/digital-wayfinding-solutions-market-forecast-to
Digital Wayfinding Solutions Market Forecast to 2028 - COVID-19 Impact and Global Analysis by...
The Global Digital Wayfinding Solutions Market, valued at USD 234.62M in 2021, is projected to reach USD 664.95M by 2028, growing at a 16% CAGR.
digital wayfinding solutions
https://events.la.psu.edu/event/wayfinding_wednesdays_what_are_enrichment_funds_and_how_can_they_support_my_internship_research_and_global_experiences/
Wayfinding Wednesdays: What are enrichment funds, and how can they support my internship, research,...
Jan 18, 2024 - Drop by the Chaiken Center for Student Success to chat with a student support staff member and learn about a resource or opportunity that could help you...
https://events.la.psu.edu/event/cc-ww_0209/
Wayfinding Wednesdays: How can a career coach help me? | Liberal Arts Events
Jan 18, 2024 - Drop by the Chaiken Center for Student Success to chat with a student support staff member and learn about a resource or opportunity that could help you...
how cancareer coach
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=&locat1=551
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://digitalwayfinding.au/
Digital Wayfinding - Smart Digital Signage, Smarter Digital Navigation
Digital Wayfinding is your ultimate solution for modern navigation, combining smart digital signage with intelligent wayfinding technology to enhance visitor...
digital wayfindingsmart signagesmarternavigation
https://ezdsign.en.made-in-china.com/product/LFRtjbZMlvTl/China-Shopping-Mall-Illuminated-Wayfinding-Advertising-Roadside-Standing-Pillar-Board-Pylon-Sign.html
Shopping Mall Illuminated Wayfinding Advertising Roadside Standing Pillar Board Pylon Sign - Pylon...
Shopping Mall Illuminated Wayfinding Advertising Roadside Standing Pillar Board Pylon Sign, Find Details and Price about Pylon Sign Shopping Mall Sign from...
shopping mallilluminatedwayfindingadvertising
https://research.monash.edu/en/publications/wayfinding-and-critical-autoethnography/
Wayfinding and critical autoethnography - Monash University
wayfindingcriticalautoethnographymonashuniversity
https://maps.ubc.ca/?show=y,y,y,y,y,y&bldg2Search=n&locat1=724&locat2=
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://scholarshare.temple.edu/entities/publication/7b8af5c0-3a54-4bd7-81a4-f3955fb25f53
The Impact of Virtual Geographies: Video Gaming and Wayfinding
Success in spatial skills can be an indicator of success in mathematics and sciences. Wayfinding, the ability to purposefully navigate, is one such important...
the impactvideo gamingvirtualgeographieswayfinding
https://www.techtarget.com/searchhrsoftware/news/252512700/Wayfinding-tools-chart-course-for-hybrid-office
Wayfinding tools chart course for hybrid office | TechTarget
The hybrid office is creating demand for wayfinding tools to help employees find their desks, quickly locate coworkers and navigate the workplace.
for hybridwayfindingtoolschartcourse
https://herva.be/
Herva-Doublet | Straatmeubilair, Gevelaankleding & Wayfinding
Herva versterkt je merk met straatmeubilair, gevelaankleding, wayfinding en interieur. Duurzame oplossingen die zichtbaarheid en beleving verhogen.
hervadoubletstraatmeubilairgevelaankledingwayfinding
https://eric.ed.gov/?id=EJ624918
ERIC - EJ624918 - Wayfinding Solutions in the Real & Virtual Worlds., Facilities Manager, 2001
Discusses some solutions for helping students and visitors to navigate around college and university campuses whether they are on- site or on-line. (GR)
wayfinding solutionsthe real
https://policy.wisc.edu/library/UW-6037
Exterior Signage, Graphics, and Wayfinding - UW-Madison Policy Library
exterior signageuw madisongraphicswayfindingpolicy
https://letine.en.made-in-china.com/product/gThUlPayHdWz/China-Interactive-Indoor-Wayfinding-Kiosk-with-Dual-Screen-Display.html
Interactive Indoor Wayfinding Kiosk with Dual Screen Display - Indoor Display and Digital Signage...
Interactive Indoor Wayfinding Kiosk with Dual Screen Display, Find Details and Price about Indoor Display Digital Signage Display from Interactive Indoor...
indoor wayfindingdual screenand digitalinteractivekiosk
https://maps.ubc.ca/?show=y,n,n,n,n,y&bldg2Search=&locat1=324
Wayfinding at UBC - Vancouver Campus | UBC Map
UBC Map. Wayfinding at UBC Vancouver Campus is a web map application enabling the UBC community to interact with and navigate the Vancouver campus.
ubc vancouverwayfindingcampusmap
https://endpointwayfindingxchange.podbean.com/e/giles-rhys-jones-%E2%80%93-a-simpler-way-to-talk-about-location/
How what3words is changing the language of location - Giles Rhys Jones, what3words | Wayfinding...
In this episode of the Wayfinding Xchange Podcast, we speak with Giles Rhys Jones about what3words and how a new approach to location is influencing navigation...
changing the language