https://projects.theforeman.org/issues/6580
Bug #6580: CVE-2014-3531 - XSS in operating system name / description - Foreman
operating systembugcvexssname
https://manpages.ubuntu.com/manpages/resolute/man7/sys_utsname.h.7posix.html
Ubuntu Manpage: sys/utsname.h - system name structure
system name structure
h systemubuntumanpagenamestructure
https://thwack.solarwinds.com/discussion/19136/lem-filtering-for-system-name-versus-ip
LEM filtering for System Name versus IP - THWACK
I often need to search for logs across a specific set of nodes managed by LEM, when doing this I normally use the "DetectionIP" as the key field. The problem...
system namelemfilteringversusip
https://forum.pulseway.com/topic/4618-what-do-the-numbers-under-the-system-name-represent/?do=showReactionsComment&comment=15800&changed=1&reaction=2
See who reacted to this (15800) - What do the numbers under the System Name represent? - General -...
reacted tothe numberssystem nameseerepresent
https://docs.boost.space/knowledge-base/bs-database/bse-getting-started/system-name-system-key/
Finding Your System Name on Boost.space: A Quick Guide
Feb 18, 2026 - Learn how to locate your unique system name for Boost.space login and integration setup, whether through URL, email, or support.
your systemquick guidefindingnameboost
https://docs.teradata.com/r/Enterprise_IntelliFlex_Lake_VMware/Teradata-Viewpoint-User-Guide-23.04/Workload-Management/Workload-Designer-Overview/Workload-Designer-Teradata-System/Model-Systems/Editing-a-Model-System-Name-Teradata-System?contentId=GyjsR2tYxr6rVw2YhZ8VhA
Editing a Model System Name (Teradata System) - Teradata Viewpoint - Teradata Workload Management
This task describes how to edit a model system name for a Teradata system.
system nameworkload managementeditingmodelteradata
https://www.commandinline.com/hostname-command-linux-guide/
hostname Command in Linux: Set and Display System Name | Command in Line
Dec 27, 2025 - Learn how to use hostname in Linux to display and change the system hostname, update /etc/hostname and /etc/hosts, and use hostnamectl for permanent hostname...
system namehostnamecommandlinuxset
https://appleinsider.com/articles/21/12/09/apple-renews-trademark-for-mammoth-operating-system-name
Apple renews trademark for 'Mammoth' operating system name | AppleInsider
Apple has reportedly renewed its trademark for the name "Mammoth," potentially hinting at the name's use for a future version of macOS.
operating systemapplerenewstrademarkmammoth
https://forum.qt.io/topic/56402/segmentation-fault-at-graphics_system_name-isempty
segmentation fault at graphics_system_name.isEmpty() | Qt Forum
Jul 16, 2015 - I have ported Qt 4.8.6 to sparc linux.as per my knowledge Sparc and Linux support is not available in qws folder. I have copied linux-generic-g++ to linux-sp...
segmentation faultsystem nameqt forumgraphicsisempty
https://www.dwellir.com/docs/bifrost/system_name
system_name | Bifrost RPC Docs | Dwellir
Get the node implementation name on Bifrost. Identify the client software powering your node for diagnostics, compatibility checks, and infrastructure...
system namerpc docsbifrost
https://www.nametagwizard.com/k-l-regency-post-acute-healthcare-system-name-tag
K&L Regency Post-Acute Healthcare System Name Badge - Name Tag Wizard
k lpost acutehealthcare systemname badgeregency
https://felgo.com/doc/qt/cmake-variable-android-ndk-host-system-name/
ANDROID_NDK_HOST_SYSTEM_NAME | Qt Core | Qt Documentation (Pro)
android ndksystem namecore documentationhostqt
https://archive.midrange.com/rpg400-l/200301/msg00362.html
RE: System name & # of recods -- RPG400-L
system namel
https://www.juniper.net/documentation/us/en/software/junos/cli-reference/topics/ref/statement/logical-system-name-edit-forwarding-options.html
logical-system-name (DHCP Relay Agent) | Junos OS | Juniper Networks
Specify that the logical system name is concatenated with the username during the subscriber authentication or client authentication process. No logical system...
dhcp relay agentsystem namejuniper networkslogicaljunos
https://pubs.lenovo.com/thinkagile-hx/update_the_appliance_name
Update the appliance/integrated system name | ThinkAgile HX series Appliance, Certified Nodes |...
When the VPD string is updated, the corresponding appliance/integrated system name will also be updated. The appliance/integrated system name should be updated...
the applianceintegrated systemhx seriesupdatename
https://aioudregrees.com/
Parked Domain name on Hostinger DNS system
parked domainnamehostingerdnssystem
https://en.wikipedia.org/wiki/Domain_Name_System
Domain Name System - Wikipedia
domain name systemwikipedia
https://thesai.org/Publications/ViewPaper?Volume=15&Issue=10&Code=IJACSA&SerialNo=121
A Secure Scheme to Counter the Man in the Middle Attacks in SDN Networks-Based Domain Name System
Internet and computer networks are vulnerable to cyber-attacks which compromise the services they provide to facilitate the management of data and users. The...
domain name systemthe mansecureschemecounter
https://www.infoblox.com/blog/tag/domain-name-system/
Domain Name System Archives - Infoblox Blog
domain name systemarchivesinfobloxblog
https://confluence.atlassian.com/bitbucketserver082/setting-a-system-wide-default-branch-name-1141979409.html
Setting a system-wide default branch name | Atlassian Support | Atlassian Documentation
setting aatlassian supportsystemwidedefault
https://control.clickhere2.com.sg/kb/answer/1907
Domain Name System Security Extensions (DNSSEC) | KnowledgeBase
domain name systemsecurityextensionsdnssecknowledgebase
https://invidis.com/sixteen-nine/tag/domain-name-system/
Domain name system | invidis
domain name systeminvidis
https://www.ibm.com/docs/en/fusion-hci-systems/2.8.x?topic=np-setting-up-dns-dhcp-storage-fusion-hci-system
Setting up DHCPSetting up DNSDynamic Host Configuration Protocol (DHCP)Domain Name System...
As a prerequisite to IBM Storage Fusion HCI System installation, update Dynamic Host Configuration Protocol (DHCP) and Domain Name System (DNS) with the...
domain name systemsetting uphostconfigurationprotocol
https://udd.debian.org/lintian-tag/dbus-system-service-wrong-name?affected=yes
UDD - Lintian tag: dbus-system-service-wrong-name
system servicelintiantagdbuswrong
https://www.oii.ox.ac.uk/news-events/videos/the-history-and-future-of-the-domain-name-system-part-3/
OII | The History and Future of the Domain Name System, Part 3
Lynn St Amour discusses the history and future of the Internet Domain Name System (DNS). The event commemorated Jon Postel by looking back at the history of...
history and futuredomain name systemoiipart
https://www.irs.gov/irm/part10/irm_10-008-005r
10.8.5 Domain Name System (DNS) Security Policy | Internal Revenue Service
domain name systeminternal revenue servicedns securitypolicy