Robuta

https://projects.theforeman.org/issues/6580 Bug #6580: CVE-2014-3531 - XSS in operating system name / description - Foreman operating systembugcvexssname https://manpages.ubuntu.com/manpages/resolute/man7/sys_utsname.h.7posix.html Ubuntu Manpage: sys/utsname.h - system name structure system name structure h systemubuntumanpagenamestructure https://thwack.solarwinds.com/discussion/19136/lem-filtering-for-system-name-versus-ip LEM filtering for System Name versus IP - THWACK I often need to search for logs across a specific set of nodes managed by LEM, when doing this I normally use the "DetectionIP" as the key field. The problem... system namelemfilteringversusip https://forum.pulseway.com/topic/4618-what-do-the-numbers-under-the-system-name-represent/?do=showReactionsComment&comment=15800&changed=1&reaction=2 See who reacted to this (15800) - What do the numbers under the System Name represent? - General -... reacted tothe numberssystem nameseerepresent https://docs.boost.space/knowledge-base/bs-database/bse-getting-started/system-name-system-key/ Finding Your System Name on Boost.space: A Quick Guide Feb 18, 2026 - Learn how to locate your unique system name for Boost.space login and integration setup, whether through URL, email, or support. your systemquick guidefindingnameboost https://docs.teradata.com/r/Enterprise_IntelliFlex_Lake_VMware/Teradata-Viewpoint-User-Guide-23.04/Workload-Management/Workload-Designer-Overview/Workload-Designer-Teradata-System/Model-Systems/Editing-a-Model-System-Name-Teradata-System?contentId=GyjsR2tYxr6rVw2YhZ8VhA Editing a Model System Name (Teradata System) - Teradata Viewpoint - Teradata Workload Management This task describes how to edit a model system name for a Teradata system. system nameworkload managementeditingmodelteradata https://www.commandinline.com/hostname-command-linux-guide/ hostname Command in Linux: Set and Display System Name | Command in Line Dec 27, 2025 - Learn how to use hostname in Linux to display and change the system hostname, update /etc/hostname and /etc/hosts, and use hostnamectl for permanent hostname... system namehostnamecommandlinuxset https://appleinsider.com/articles/21/12/09/apple-renews-trademark-for-mammoth-operating-system-name Apple renews trademark for 'Mammoth' operating system name | AppleInsider Apple has reportedly renewed its trademark for the name "Mammoth," potentially hinting at the name's use for a future version of macOS. operating systemapplerenewstrademarkmammoth https://forum.qt.io/topic/56402/segmentation-fault-at-graphics_system_name-isempty segmentation fault at graphics_system_name.isEmpty() | Qt Forum Jul 16, 2015 - I have ported Qt 4.8.6 to sparc linux.as per my knowledge Sparc and Linux support is not available in qws folder. I have copied linux-generic-g++ to linux-sp... segmentation faultsystem nameqt forumgraphicsisempty https://www.dwellir.com/docs/bifrost/system_name system_name | Bifrost RPC Docs | Dwellir Get the node implementation name on Bifrost. Identify the client software powering your node for diagnostics, compatibility checks, and infrastructure... system namerpc docsbifrost https://www.nametagwizard.com/k-l-regency-post-acute-healthcare-system-name-tag K&L Regency Post-Acute Healthcare System Name Badge - Name Tag Wizard k lpost acutehealthcare systemname badgeregency https://felgo.com/doc/qt/cmake-variable-android-ndk-host-system-name/ ANDROID_NDK_HOST_SYSTEM_NAME | Qt Core | Qt Documentation (Pro) android ndksystem namecore documentationhostqt https://archive.midrange.com/rpg400-l/200301/msg00362.html RE: System name & # of recods -- RPG400-L system namel https://www.juniper.net/documentation/us/en/software/junos/cli-reference/topics/ref/statement/logical-system-name-edit-forwarding-options.html logical-system-name (DHCP Relay Agent) | Junos OS | Juniper Networks Specify that the logical system name is concatenated with the username during the subscriber authentication or client authentication process. No logical system... dhcp relay agentsystem namejuniper networkslogicaljunos https://pubs.lenovo.com/thinkagile-hx/update_the_appliance_name Update the appliance/integrated system name | ThinkAgile HX series Appliance, Certified Nodes |... When the VPD string is updated, the corresponding appliance/integrated system name will also be updated. The appliance/integrated system name should be updated... the applianceintegrated systemhx seriesupdatename https://aioudregrees.com/ Parked Domain name on Hostinger DNS system parked domainnamehostingerdnssystem https://en.wikipedia.org/wiki/Domain_Name_System Domain Name System - Wikipedia domain name systemwikipedia https://thesai.org/Publications/ViewPaper?Volume=15&Issue=10&Code=IJACSA&SerialNo=121 A Secure Scheme to Counter the Man in the Middle Attacks in SDN Networks-Based Domain Name System Internet and computer networks are vulnerable to cyber-attacks which compromise the services they provide to facilitate the management of data and users. The... domain name systemthe mansecureschemecounter https://www.infoblox.com/blog/tag/domain-name-system/ Domain Name System Archives - Infoblox Blog domain name systemarchivesinfobloxblog https://confluence.atlassian.com/bitbucketserver082/setting-a-system-wide-default-branch-name-1141979409.html Setting a system-wide default branch name | Atlassian Support | Atlassian Documentation setting aatlassian supportsystemwidedefault https://control.clickhere2.com.sg/kb/answer/1907 Domain Name System Security Extensions (DNSSEC) | KnowledgeBase domain name systemsecurityextensionsdnssecknowledgebase https://invidis.com/sixteen-nine/tag/domain-name-system/ Domain name system | invidis domain name systeminvidis https://www.ibm.com/docs/en/fusion-hci-systems/2.8.x?topic=np-setting-up-dns-dhcp-storage-fusion-hci-system Setting up DHCPSetting up DNSDynamic Host Configuration Protocol (DHCP)Domain Name System... As a prerequisite to IBM Storage Fusion HCI System installation, update Dynamic Host Configuration Protocol (DHCP) and Domain Name System (DNS) with the... domain name systemsetting uphostconfigurationprotocol https://udd.debian.org/lintian-tag/dbus-system-service-wrong-name?affected=yes UDD - Lintian tag: dbus-system-service-wrong-name system servicelintiantagdbuswrong https://www.oii.ox.ac.uk/news-events/videos/the-history-and-future-of-the-domain-name-system-part-3/ OII | The History and Future of the Domain Name System, Part 3 Lynn St Amour discusses the history and future of the Internet Domain Name System (DNS). The event commemorated Jon Postel by looking back at the history of... history and futuredomain name systemoiipart https://www.irs.gov/irm/part10/irm_10-008-005r 10.8.5 Domain Name System (DNS) Security Policy | Internal Revenue Service domain name systeminternal revenue servicedns securitypolicy