https://careers.playground.global/companies/agility-robotics/jobs/84070601-senior-hardware-test-engineer-mechatronics
Senior Hardware Test Engineer - Mechatronics @ Agility Robotics | Playground Global Job Board
Search job openings across the Playground Global network.
test engineeragility roboticsplayground globaljob boardsenior
https://qatestingjobs.com/jobs/526250-lead-test-engineer-uav
Lead Test Engineer (UAV) at Redwire Space - QATestingJobs.com
test engineerredwire spaceleaduav
https://careers.ovalpark.com/companies/swir-vision-systems/jobs/94245809-product-test-engineer
Product/ Test Engineer @ SWIR Vision Systems | Oval Park Job Board
Search job openings across the Oval Park network.
product testoval parkjob boardengineerswir
https://talent.cherry.vc/companies/the-exploration-company/jobs/94878397-ait-test-engineer
AIT Test Engineer @ The Exploration Company | Cherry Ventures Job Board
Search job openings across the Cherry Ventures network.
the exploration companytest engineerjob boardaitcherry
https://cloudcomputingjobs.co.uk/jobs/principal-test-engineer-matchtech-stockport
Principal Test Engineer - Matchtech - Stockport | Cloud Computing Jobs
This role involves leading the end-to-end software testing lifecycle across large-scale programmes, designing and evolving test automation frameworks, and...
test engineercloud computingprincipalstockportjobs
https://werkenbij.dela.nl/Ilja-Nelen-over-zijn-werk-als-test-engineer-bij-DELA
Ilja Nelen over zijn werk als test engineer bij DELA | Werken bij DELA
Informatietechnologie is binnen DELA het snelst groeiende vakgebied. Vanuit DELA zetten we dan ook vol in op hoogstaande IT. Hoe we dat doen lees je hier.
test engineeriljazijnwerkals
https://testingjob.in/ingersoll-rand-recruitment-hiring-test-engineer/
Ingersoll Rand recruitment drive - Hiring Test Engineer for Bangalore location -
Sep 28, 2024 - Ingersoll Rand is hiring for Test Engineer at Bengaluru location. Interested candidates are encouraged to apply before the application deadline.
ingersoll randtest engineerrecruitmentdrivehiring
https://jobs.luxcapital.com/companies/anduril/jobs/93455788-flight-test-engineer
Flight Test Engineer @ Anduril | Lux Capital Job Board
Search job openings across the Lux Capital network.
flight test engineerlux capitaljob boardanduril
https://www.hireitpeople.com/resume-database/67-quality-assurance-qa-resumes/82906-automation-test-engineer-resume-ashburn-va
Automation Test Engineer Resume Ashburn, VA - Hire IT People - We get IT done
Strong knowledge of software development processes and methodologies Familiarity with testing distributed application in large Web - based environmentsStrong...
test engineerashburn vaautomationresumehire
https://jobs.keysight.com/external/jobs/54616?lang=en-us
Manufacturing Test Engineer, Entry in Penang, Malaysia | Keysight Technologies, Inc.
Keysight Careers is hiring a Manufacturing Test Engineer, Entry in Penang, Malaysia. Review all of the job details and apply today!
keysight technologies inctest engineermanufacturingentrypenang
https://www.amentumcareers.com/jobs/entry-level-radiation-test-engineer-crane-indiana-united-states
Entry Level Radiation Test Engineer - Crane, Indiana, United States
Are you looking for an exciting, innovative company with over 100 years of excellence and commitment to ethical business? Amentum is a trusted partner to...
entry leveltest engineerunited statesradiationcrane
https://builtinchennai.in/job/network-system-test-engineer-manual-solution/7144880
Network System Test Engineer (Manual/Solution) - Arista Channels | Built In Chennai
Arista Channels is hiring for a Network System Test Engineer (Manual/Solution) in Chennai, Tamil Nadu, IND. Find more details about the job and how to apply at...
system testbuilt innetworkengineermanual
https://swissbit.jobs.personio.de/job/2804925
Production Test Engineer (m/f/d) | Jobs bei Swissbit
Swissbit ist Europas führender Anbieter von Speicher- und Security-Lösungen für Industrie und IoT.Wir entwickeln und produzieren in Deutschland – für höchste...
test engineerm fproductionjobsbei
https://careers.thalesgroup.com/fr/fr/job/R0331859/System-Test-Engineer
System Test Engineer à Hengelo, Overijssel, 7554 RR | Industrie chez Thales Group
Postulez à System Test Engineer emploi au sein chez Thales en Hengelo, Overijssel, 7554 RR. Industrie chez Thales Group
system testthales groupengineerhengelooverijssel
https://www.neatstack.studio/resume-examples/test-engineer
Test Engineer Resume Example & Template (2026) | Neat Stack
Test Engineer resume example with ATS-optimized keywords, quantified achievements, and a skills section tailored for test engineer roles. Download or build...
test engineerresumeexampletemplateneat
https://testconsultancy.nl/events/tmap-next-test-engineer-2/
TMap Next Test Engineer – Testconsultancy Groep
test engineertmapnextgroep
https://careers-mercuryinsurance.icims.com/jobs/5969/senior-test-engineer/job
Senior Test Engineer in Remote | Careers at Remote - United States
Remote - United States is now hiring a Senior Test Engineer in Remote. Review all of the job details and apply today!
test engineerunited statesseniorremotecareers
https://careers.rtx.com/cn/zh/job/01871336/Senior-Electrical-Test-Engineer-Global-Tech-Solutions-Onsite
Senior Electrical Test Engineer, Global Tech Solutions (Onsite) in cedar rapids, Iowa, United...
Apply for Senior Electrical Test Engineer, Global Tech Solutions (Onsite) job with Raytheon in cedar rapids, Iowa, United States of America. 工程 at Raytheon
test engineercedar rapidsseniorelectricalglobal
https://sajed.kntu.ac.ir/job-details/135
سامانه ساجد - (Junior) Software Test Engineer
سامانه مهارت افزایی و هدایت شغلی دانشکاه ها
software testjuniorengineer
https://jobs.eniac.vc/companies/xwing/jobs/64823479-test-engineer-energy-storage-and-distribution-systems
Test Engineer (Energy Storage and Distribution Systems) @ XWING | Eniac Ventures Job Board
Search job openings across the Eniac Ventures network.
test engineerenergy storagejob boarddistributionsystems
https://www.adventuretech.us/copy-of-system-engineer-level-1-fc
Test Engineer, Level 2 | My Site
test engineermy sitelevel
https://www.sram.com/es/company/careers/current-openings/test-engineer
Test Engineer | SRAM
test engineersram
https://talent.emcap.com/companies/saronic-technologies-2/jobs/93607286-senior-electrical-r-d-test-engineer
Senior Electrical R&D Test Engineer @ Saronic Technologies | Emergence Capital Job Board
Search for opportunities across the Emergence Capital Portfolio.
r dtest engineerjob boardseniorelectrical
Sponsored https://www.college-flings.com/enter.php?prg=1&id=robuta&t=best&ad_id=collegeflings_315x300_df_3.jpg
CollegeFlings
Find your next college fling. Join for free today.
https://jobs.discovertechnata.com/companies/ciena-2/jobs/89612753-npi-optical-test-engineer
NPI Optical Test Engineer @ Ciena | Discover Technata Job Board
Search job openings across the Discover Technata network.
test engineerjob boardnpiopticalciena
https://remoteleads.io/company/devpro/junior-test-engineer-automation-python-op02251-00-bulgaria/
Junior Test Engineer Automation (Python) - OP02251-00 at Dev.Pro - Remote | RemoteLeads
Apply for Remote Junior Test Engineer Automation (Python) - OP02251-00 at Dev.Pro. Find hand-screened remote jobs on RemoteLeads. Apply now.
test engineerjuniorautomationpythondev
https://hireson.com/jobview?id_jobpost=87
Software Tester / Software Test Engineer / Software QA Engineer , Pune, HiresOn
Our platform is designed to make the hiring process more efficient, effective and streamlined by connecting corporates with the best hiring agencies and talent...
software testerengineerpune
https://careers.kompas.vc/companies/array-labs/jobs/83928634-rf-test-engineer
RF Test Engineer @ Array Labs | KOMPAS VC Job Board
Search job openings across the KOMPAS VC network.
rf testjob boardengineerarraylabs
https://www.uhired.ai/jobs/gh-andurilindustries-5244115007
Electrical Test Engineer at Anduril Industries | uHired
Anduril Industries seeks a Camera Test Engineer to ensure the quality of advanced defense technology products. This role involves creative problem-solving,
test engineeranduril industrieselectrical
https://www.interviewplus.ai/jd/security-test-engineer-interview-questions/710
Security Test Engineer Interview Questions
Latest vulnerability assessment, security testing, ci/cd, cloud technologies interview questions curated by our community related to security test engineer ...
test engineerinterview questionssecurity
https://jobs.boeing.com/job/annapolis-junction/test-engineer-mid-level/185/98722550368
Test Engineer - Mid Level at Boeing
Learn more about applying for Test Engineer - Mid Level at Boeing
test engineermidlevelboeing
https://joblumin.com/jobs/6055/cucumber-test-engineer
Cucumber Test Engineer at parichhat tech | JobLumin | JobLumin
Cucumber Test Engineer at parichhat tech in Gurgaon. INR 600000.00 - 900000.00. Apply now for this Full-time position.
test engineercucumbertech
https://www.cjhunter.com/jobsearch/showjob.html?resultid=JDPI2W&offset=142&PageSize=ALL&PageTitle=%3Cspan+style%3D%27font-weight%3Abold%27%3ESr.+Hardware+Test+Engineer+-+%3C%2Fspan%3EThe+Senior+Test+Engineer+will+architect+and+lead+development+of+integrated+hardware+and+software+test+platforms+that+generate+Electrical+Ground+Support+Equipment+%28EGSE%29+for+validat..&SIDW=787271adb5bebb257998ad1d7a436a27.VUlEPTQwOTI1Njk2
ContractJobHunter powered by Contract Employment Weekly - Sr. Hardware Test Engineer - The Senior...
powered bytest engineerthe seniorcontractemployment
https://www.canarywharfian.co.uk/jobs/deutsche-borse/test-engineer-fmd/b1d3fe34-2525-41e8-8780-405579334c80
Test Engineer (f/m/d) at Deutsche Borse | Canary Wharfian
**Test Engineer (f/m/d) - Cloud Post Trade Systems in Prague** Join our Prague IT center as a Test...
test engineerf mdeutsche borsecanary
https://echojobs.io/job/jabil-test-engineer-ii-i2a65
Test Engineer at Jabil · EchoJobs
Test Engineer II Location: Dublin Time Type: Full time Job Description At Jabil (NYSE: JBL), we are proud to be a trusted partner for the world's top…
test engineerjabil
Sponsored https://www.fuckdate.com/enter.php?prg=1&id=robuta&t=best&ad_id=fuckdate_300x250_202201_1.jpg
Find a Fuck Buddy at Fuckdate.com
Fuckdate.com casual dating on your mobile or iPhone. Use your phone to browse thousands of singles in your area.
https://www.kolaborate.africa/jobs/yn705zy1c9eyvr268j0107tqh58cdg5t
Test Engineer – Maternity Cover | Kolaborate | Kolaborate Jobs
The Save the Children Fund, commonly known as Save the Children, is an international non-governmental organization that promotes children’s rights, provides re…
test engineermaternity coverjobs
Sponsored https://www.sexyfans.app/enter.php?prg=1&id=robuta&t=best&ad_id=sexyfans_300x250_gif_pg.gif
Sexyfans.app - Only Fans of Dating Apps
The only dating app for fans to meet up with local content creators.
https://sysadminjobs.com/jobs/test-engineer-technician-1b294a98
Test Engineer Technician
Test Engineer Technician in Salt Lake City, Utah – Grow your career at Torus. $23 - $27/hr. Perks include Equity and Free snacks. Apply today!
test engineertechnician
https://jobs.teradyne.com/Teradyne/job/Basak%2C-Lapu-Lapu-City-Test-Engineer-Debug-and-Efficiency-Improvement-Focus-GCS-CSO-%2C-Philippines-Cebu/1334757100/
Test Engineer - Debug and Efficiency Improvement Focus : GCS : CSO , Philippines: Cebu Job Details...
Basak, Lapu-Lapu City Test Engineer - Debug and Efficiency Improvement Focus : GCS : CSO , Philippines: Cebu
test engineerjob detailsdebugefficiencyimprovement
https://www.dice.com/job-detail/26a4e80f-99f0-4146-b6a7-33c820a5b716
Integration & Test Engineer, Weekend 3rd & 4th Shift - Apex Systems - Baltimore, MD, US | Dice.com
integration testbaltimore mdengineerweekendshift
https://qatestingjobs.com/jobs/439376-automated-test-engineer-tlm-006
Automated Test Engineer (TLM - 006) at SageCor Solutions - QATestingJobs.com
automated testengineertlmsolutions
https://theorg.com/org/lockheed-martin/person/devin-king
Devin King - Staff Systems Integration / Test Engineer at Lockheed Martin | The Org
View Devin King at Lockheed Martin on The Org
staff systemsintegration testlockheed martindevinking
https://jobs.luxcapital.com/companies/observable-space-2/jobs/73421722-sr-test-engineer-hitl
Sr. Test Engineer, HITL @ Observable Space | Lux Capital Job Board
Search job openings across the Lux Capital network.
test engineerlux capitaljob boardhitlobservable
https://careers.tdsynnex.com/global/es/job/TSQTSBUSR53192EXTERNALESGLOBAL/Test-Engineer
Test Engineer in Beijing, Beijing, China | Pasantías y otros roles at Tech Data
Apply for Test Engineer job in Beijing, Beijing, China. Pasantías y otros roles at Tech Data
test engineerbeijing chinatech dataotrosroles
https://jobs.northropgrumman.com/careers/job/1340072368558-principal-systems-test-engineer-united-states-georgia-warner-robins?domain=ngc.com
Principal Systems Test Engineer | Northrop Grumman
Perform technical analysis, reviews and recommendations of hardware and electrical system for manufacturability. Design, build and validate test fixtures, wire...
systems testnorthrop grummanprincipalengineer
https://teklaresearch.catsone.com/careers/38376-General/jobs/16859329-CUAS-Flight-Test-Engineer/
CUAS Flight Test Engineer
Must be a U.S. Citizen Clearance Required: Top Secret Education: Bachelor of Science (BS) in an Engineering or Science related technical field discipline, or...
flight test engineercuas
Sponsored https://www.xlovecam.com/prm03/textlink?id_affilie=26457&p=online&tri=10
Best Live Sex Cam Shows with Free Live Chat | XLoveCam
Watch thousands of cam girls get naked on XLoveCam.
https://sysadminjobs.com/jobs/test-engineer-compute-payload-starmind-5c3b500e
Test Engineer, Compute Payload (Starmind)
Test Engineer, Compute Payload (Starmind) in Bastrop, Texas at SpaceX. Discover competitive compensation, outstanding benefits, exciting. Apply today!
test engineercomputepayloadstarmind
https://demo.kardow.com/companies/caci-international-inc/jobs/software-test-engineer-0abf64df61bb432f8dfad7af0fe863c2
Software Test Engineer at CACI International Inc | Chantilly, VA | Kardow.com
CACI International Inc is hiring: Software Test Engineer in Chantilly, VA. Pays $104k-$218k/yr. Posted Sep 29, 2026. Apply now on Kardow.com.
caci international incsoftware testchantilly vaengineer
https://at.trabajo.org/stellenangebot-2247-6a7ffc3e2fb46da4e68cd7d85ddd1518
Test Engineer – Hybrid Testing for Precision Systems in Villach, Kärnten - Lam Research
Test Engineer – Hybrid Testing for Precision Systems - Lam Research - Villach, Kärnten. Lam Research in Villach, Austria, is seeking a Test Engineer to desig...
test engineerlam researchhybridtestingprecision
https://jobs.3one4capital.com/companies/the-eplane-company-2-1910a29d-f95d-40c3-88c9-34c8cd52fbc8/jobs/88583155-flight-mechanics-test-engineer
Flight Mechanics Test Engineer @ The Eplane Company | 3one4 Capital Job Board
Search job openings across the 3one4 Capital network.
flight mechanicstest engineerjob boardcompanycapital
https://www.randstad.com/jobs/united-kingdom/s-information-technology/r-test-engineer/
Test Engineer Jobs & Vacancies | Apply Now | Randstad
Browse 3 Test Engineer jobs at Randstad. Choose from jobs that’ll help you reach your career goals
test engineerapply nowjobsvacanciesrandstad
https://job-boards.greenhouse.io/andurilindustries/jobs/5250143007?gh_jid=5250143007
Job Application for Manufacturing Test Engineer, Product & Integration at Anduril Industries
Quincy, Massachusetts, United States
job applicationtest engineerproduct integrationanduril industriesmanufacturing
Sponsored https://www.fling.com/enter.php?prg=1&id=robuta&t=best&ad_id=fl_315x300_9.jpg
Fling OFFICIAL | Biggest Dating Site For The Curious! FREE registration
Looking for real connections? Fling matches verified singles in a safe, inclusive community. Find your perfect match with full support.
https://rrgroup.co.uk/job/electrical-test-engineer/
Electrical Test Engineer - Reflect Recruitment Group
Oct 5, 2026 - Electrical Test Engineer – Low Voltage Control Panels Full Time. Permanent. £31,000 – £36,000 DOE Grantham Are you an experienced Electrical Test Engineer...
test engineerelectricalreflectrecruitmentgroup
https://analyticsjobs.in/jobs/s/etl-test-engineer-performance-testing-gartner/
ETL Test Engineer - Performance Testing - Gartner - Analytics Jobs
Job Description About Gartner IT: Join an exceptional team of skilled engineers dedicated to crafting innovative digital solutions that empower our colleagues...
test engineerperformance testingetlgartneranalytics
https://careers.nttdata.com/br/pt/job/bd9e876a2e07500/Senior-Test-Engineer-with-Agentic-AI
Senior Test Engineer with Agentic AI trabalho em Cluj, Romania | Technical Engineering empregos na...
Candidate-se a Senior Test Engineer with Agentic AI vaga na NTT Data em Cluj, Romania. Navegue e se candidate para vagas Technical Engineering na NTT Data
test engineeragentic aitechnical engineeringseniortrabalho
https://aidevboard.com/job/test-engineer-rd-7707cb2c
Test Engineer, Thermofluids at FluidStack — AI Dev Jobs
Test Engineer, Thermofluids at FluidStack — On-site, Austin, TX. Mid-level role. Apply on AI Dev Jobs.
test engineerthermofluidsdevjobs
https://jobs.weekday.works/functional-test-engineer-at-gainwell-technologies-wkdy6rcv1l
Gainwell Technologies hiring for Functional Test Engineer
Gainwell Technologies Website: gainwelltechnologies.com Job details: Summary As an Functional Test Engineer at Gainwell,you will be supporting the full…
functional testgainwelltechnologieshiringengineer
https://workingreen.jobs/offers/senior-test-engineer-systems-test-at-form-energy-weirton-wv
Senior Test Engineer, Systems Test - Form Energy | Work in Green
Senior Test Engineer, Systems Test at Form Energy (Weirton, WV, United States). Senior · Full time. Apply directly on Work in Green — the climate jobs board.
test engineerform energyseniorsystemswork
https://jobs.hiringourheroes.org/jobs/681462151-test-engineer-e2
Test Engineer - E2 at Lockheed Martin - Hiring Our Heroes Job Board
hiring our heroestest engineerlockheed martinjob board
https://jobs.decisivepoint.com/companies/episci/jobs/82329236-autonomous-vehicle-test-engineer
Autonomous Vehicle Test Engineer @ EpiSci | Decisive Point Job Board
Search job openings across the Decisive Point network.
autonomous vehicletest engineerjob boarddecisivepoint
https://careers.televic.com/fr/jobs/rail/system-test-engineer-m-w-d-berlin-televic-rail-gmbh/
System Test Engineer (m/w/d) – Berlin – Televic Rail GmbH - Televic
system testw dengineerberlinrail
https://jobs.outsidersfund.com/companies/apex-2-6f68cf3c-7476-41f4-b599-5ef92c5e7ffd/jobs/95319987-avionics-test-engineer
Avionics Test Engineer @ Apex | Outsiders Fund Job Board
Search job openings across the Outsiders Fund network.
test engineerjob boardavionicsapexoutsiders
https://www.dice.com/job-detail/57fea1cd-8289-43bf-85bb-29e2b8f85894
Flight Test Engineer - Stratolaunch - Mojave, CA, US | Dice.com
30+ days ago - Stratolaunch is a technology accelerator that engineers operationally realistic testing at Mach 5+. Our air-launched, Talon testbeds ar...
flight test engineerstratolaunchmojavedice
https://kcs-group.in/automation-test-engineer-sdet-capgemini-technology-services-bengaluru-walk-in-drive/
Automation Test Engineer - SDET | Capgemini Technology Services | Bengaluru (Walk-in Drive) - KCS...
Apr 10, 2026 - We are looking for a highly skilled Software Development Engineer in Test (SDET) with 4 to 6 years of strong experience in Java-based test automation, UI
test engineertechnology servicesautomationsdetcapgemini
https://jobs.luxcapital.com/companies/applied-compute-2/jobs/95453632-flight-test-engineer
Flight Test Engineer @ Applied Compute | Lux Capital Job Board
Search job openings across the Lux Capital network.
flight test engineerlux capitaljob boardappliedcompute
https://jobs.anitab.org/companies/amazon-3-60ad394d-c673-4474-9694-344b0cae748f/jobs/94494508-production-test-engineer-leo-propulsion-production-test-team
Production Test Engineer, Leo Propulsion Production Test Team @ Amazon | anitab.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
test engineerjob boardproductionleopropulsion
Sponsored https://www.camsoda.ai/?id=robuta&ad_id=ai_300x250_10
Camsoda AI: AI Girlfriend App for Chatting, Photos, and Voice
Camsoda AI is the AI girlfriend app for real-time chat, photos, and voice. Pick from 200+ characters or create your own. Free to start.
https://www.jobswype.cz/prace/-software%20test%20engineer-
Software Test Engineer pracovních nabídek v Česko
5746 Software Test Engineer pracovních nabídek v Česko. Všechny pracovní nabídky naleznete na Jobswype.
software testengineer
https://www.amjobhunter.info/2014/01/aspire-systems-india-walkin-drive-for.html
Aspire Systems India walkin drive for Freshers As Test engineer position -...
Apply for all indian jobs . Get all job vacancy details near you . Get your dream job in 60 days
test engineeraspiresystemsindiawalkin
https://qatutor.com/wp-content/uploads/2014/06/first_resume.htm
Example of QA/Test Engineer Resume for the first job in a Software Testing
for the firsttest engineersoftware testingexampleresume
https://jobs.apple.com/it-it/details/200676417-3543/system-test-engineer-5g-6g-wireless-interoperability-wireless-technologies-and-ecosystems
System Test Engineer, 5G/6G Wireless Interoperability - Wireless Technologies and Ecosystems -...
Applicare un lavoro System Test Engineer, 5G/6G Wireless Interoperability - Wireless Technologies and Ecosystems a Apple. Leggi il ruolo e scopri se è giusto...
system testengineerwirelessinteroperabilitytechnologies
https://first-military.co.uk/job/senior-test-engineer/
... Senior Test Engineer | First Military Recruitment
test engineermilitary recruitmentseniorfirst
https://astekcorp.com/employment/software-test-engineer/
Software Test Engineer – Astek Corporation
software testengineercorporation
https://eu-recruit.com/jobs/test-engineer-2/
Test Engineer - European Tech Recruit
test engineereuropeantechrecruit
https://jobs.engine.xyz/companies/celestial-ai/jobs/81404114-senior-staff-test-engineer
Senior Staff Test Engineer @ Celestial AI | The Engine Job Board
Search job openings across the The Engine network.
senior stafftest engineerjob boardcelestial
https://personato.nl/items/nl/vacatures/techniek/integratie-test-engineer-vacancies-6915-b
Vacatures - Integratie & Test Engineer - Personato
Ben jij graag bezig met techniek die écht werkt? Wil je niet alleen machines bouwen, maar ook zorgen dat ze perfect worden afgesteld, getest en klaar zijn voor...
test engineervacaturesintegratiepersonato
https://careers.atomico.com/companies/neko-health/jobs/94272459-lead-test-engineer-electronics
Lead Test Engineer, Electronics @ Neko Health | Atomico Job Board
Search job openings across the Atomico network.
test engineerneko healthjob boardleadelectronics
https://hrfy.com/jobs/teambees-corp/manual-test-engineer-gurgaon-69b3a773c4c655d5794895bb
Manual Test Engineer (Gurgaon) at TeamBees Corp | HRFY.ai
Focus on areas such as manual testing methodologies, including functional testing, defect tracking, user acceptance testing (UAT), exploratory testing, and...
test engineermanualgurgaoncorp
https://jobs.anitab.org/companies/dev-technology-group-inc-2/jobs/94614397-software-test-engineer-power-platforms
Software Test Engineer - Power Platforms @ Dev Technology Group, Inc. | anitab.org Job Board
Join the AnitaB.org Job Board and Talent Network to search for jobs, explore companies, and upload your resume to find opportunities tailored just for you!
software testjob boardengineerpowerplatforms
https://www.ingjobs.ch/de/job/14722960
Test Engineer Product Safety, Nänikon-Greifensee - Mettler Toledo
Über Mettler Toledo METTLER TOLEDO ist ein weltweit führender Anbieter von Präzisionsinstrumenten und Dienstleistungen.
test engineerproduct safetymettler toledogreifensee
https://jobs.paccar.com/job/Mount-Vernon-ECU-Test-Engineer-WA-98273-9671/1435471933/
ECU Test Engineer Job Details | PACCAR
Mount Vernon ECU Test Engineer - WA, 98273-9671
test engineerjob detailsecupaccar
https://qatestingjobs.com/jobs/230762-evosoft-senior-software-test-engineer-industrial-automation
evosoft - Senior Software Test Engineer – Industrial Automation at evosoft - QATestingJobs.com
software testindustrial automationseniorengineer
https://jobs.kaporcapital.com/companies/formlabs-2/jobs/95253011-r-d-reliability-test-engineer-june-2027-grads
R&D Reliability/Test Engineer - June 2027 Grads @ Formlabs | Kapor Capital Job Board
Search job openings across the Kapor Capital network.
r dreliability testkapor capitaljob boardengineer
https://www.talent.com/jobs/k-automation-test-engineer-l-mckinney-tx
automation test engineer Jobs in McKinney, TX | Hiring Now | Talent.com
Find automation test engineer jobs in McKinney, TX hiring now on Talent.com. Discover your next career opportunity today and apply now!
test engineermckinney txhiring nowautomationjobs
https://www.hirist.tech/j/desktop-application-test-engineer-c-qt-qml-1642444?ref=kp_br&jobPos=2
Desktop Application Test Engineer - C++/QT/Qml | hirist.tech
Job Description for Desktop Application Test Engineer - C++/QT/Qml in Blue Ocean Systems in Navi Mumbai for (5-10) years of experience. Apply Now!
desktop applicationtest engineerqmltech
https://qatestingjobs.com/jobs/538281-technical-test-engineer
Technical Test Engineer at Accenture - QATestingJobs.com
test engineertechnicalaccenture
https://merademyjobs.com/index.php/2024/12/29/zoho-is-hiring-for-software-development-qa-test-engineer-devops-engineer-apply-now/
Zoho is hiring for Software Development/ QA Test Engineer/ DevOps Engineer | Apply Now! – Merademy
software developmenttest engineerapply nowzohohiring
https://levelrecruitment.se/lediga-jobb/193520/
System Integration Test Engineer – Be a part of DeLaval´s continuing success – Level Recruitment
system integrationtest engineerpart ofcontinuingsuccess
https://job-boards.greenhouse.io/andurilindustries/jobs/5240246007
Job Application for Senior RF Systems Integration & Test Engineer at Anduril Industries
Costa Mesa, California, United States
job applicationsystems integrationtest engineeranduril industriessenior
https://careers.teksystems.com/ca/fr/job/JP-006293417/Test-Engineer-Linux-Systems-Testing
Test Engineer (Linux / Systems Testing) in Irvine, California, USA | Testeur at TEKsystems
Apply for Test Engineer (Linux / Systems Testing) job with TEKsystems in Irvine, California, USA. Testeur at TEKsystems
test engineersystems testingirvine californialinuxusa
https://work.mercor.com/jobs/list_AAABnqnIyS541fa8hXtHfJex/code-data-eval-author-software-test-engineer-sdet-pilot?referralCode=82d5f4e3-e1a3-4064-963f-c197bb2c8db1
Code-Data Eval Author — Software Test Engineer / SDET (Pilot) - Mercor Jobs
Code-Data Eval Author — Software Test Engineer / SDET (Mercor · remote contract) Mercor partners with frontier AI labs to build the evaluations their coding…
software testcodedataevalauthor
https://legal.skyengrussia.ru/doc/view/UP_DO_Test_Engineer_524_hours
UP_DO_Test_Engineer_524_hours
up dotest engineerhours
https://en.itenest.com/news/129.html
Software test engineer recruitment- iTest Technology Co., Ltd._WLAN Products_VNA Products
software testengineerrecruitmenttechnologyltd
https://portfoliocareers.shieldcap.com/companies/apex-2-6f68cf3c-7476-41f4-b599-5ef92c5e7ffd/jobs/72310297-lead-environmental-test-engineer
Lead Environmental Test Engineer @ Apex | SHIELD Job Board
Search job openings across the SHIELD network.
environmental testjob boardleadengineerapex
https://atshire.com/all-jobs/rf-test-engineer-8/
RF Test Engineer | ATS Executive Search and Recruiter
POSTING DATE: 1.27.26 We are working on behalf of a fast-growing fabless semiconductor company that specializes in RF and millimeter-wave technologies. Our...
rf testexecutive searchengineeratsrecruiter
https://www.swiftcruit.ai/jobs/flight-test-engineer-r5006-268535
Flight Test Engineer, R5898 at Shield AI in Wichita, Kansas | Swiftcruit
Explore the Flight Test Engineer, R5898 role at Shield AI in Wichita, Kansas. Review salary, work mode, required skills, AI Match insights, role-specific…
flight test engineershield aiwichita kansas
https://my.talent.com/view?id=623542102956649207
Software Test Engineer – TD SYNNEX – Pekerjaan Petaling Jaya, Selangor
Memohon Software Test Engineer di Petaling Jaya, Selangor. TD SYNNEX sedang mengambil pekerja sekarang. Terokai peluang kerjaya anda yang seterusnya hari ini...
software testtd synnexpetaling jayaengineerpekerjaan
https://careers.cobioscience.com/job/5283/software-quality-test-engineer-4/
Software Quality Test Engineer 4 in Lakewood, CO | Colorado Bioscience Association Career Center
Requisition ID: 35444 At Terumo Blood and Cell Technologies, our 8,000+ global associates proud to come to work each day, knowing that what we do...
software qualitytest engineerlakewood cocareer centercolorado
https://cymertek.catsone.com/careers/42454/jobs/16614231-Test-Engineer
Test Engineer
Test EngineerLOCATIONReston, VA 20190CLEARANCETS/SCI Full Poly (Please note this position requires full U.S. Citizenship)KEY SUMMARYWe are seeking a dedicated...
test engineer
https://connectedbusinesses.co.il/job-offer/software-test-engineer-ii/
Software Test Engineer II - COB - Career on board
This is an on-site, full-time position based in Kefar Sava, Israel, reporting directly to the Software QA Team Leader. The engineer will own both manual and
software teston boardengineercobcareer
https://fresherscamp.com/siemens-off-campus-2024/
Siemens Off Campus 2024 : Mass Hiring as Test Engineer | Apply Now
Siemens Off Campus 2024 : Mass Hiring as Test Engineer | Apply Now - Latest Jobs for Freshers and Recent Campus News FreshersCamp
off campustest engineerapply nowsiemensmass
https://joblumin.com/jobs/4506/load-test-engineer
Load Test Engineer at Globe Consultancy | JobLumin | JobLumin
Load Test Engineer at Globe Consultancy in Gurgaon. INR 600000.00 - 900000.00. Apply now for this Full-time position.
load testengineerglobeconsultancy
https://www.fusionenergybase.com/jobs/4090
Senior R&D Test Engineer - Fluid Systems at Commonwealth Fusion Systems | Fusion Energy Base
r dtest engineercommonwealth fusionseniorfluid
