https://mayathegreenstar.com/
Explore a story of art, mythology, and music in Maya the Green Star. A conscious star transforms into Uman, awakening the Universe.
the greenstar acosmic odysseymayaart
https://mediamythalert.com/2010/09/11/cronkite-moment-makes-best-of-the-web/
The appearance in “Best of the Web” was the latest in a recent spate of sitings of the “Cronkite Moment.”
best ofthe webcronkitemomentmakes
https://www.androidauthority.com/why-you-dont-want-that-32-bit-dac-667621/
Aug 24, 2019 - There is a growing trend of shoving a 32-bit DAC into flagship smartphones, but this is nothing more than a marketing gimmick. Here is why.
the greataudiomythneed
https://www.christianbook.com/madame-blavatsky-woman-behind-myth-ebook/marion-meade/9781497602250/pd/63798EB
Madame Blavatsky: The Woman Behind the Myth - eBook (9781497602250) by Marion Meade
madame blavatskythe womanmarion meadebehindmyth
https://unherd.com/2023/04/does-trump-fight-like-a-pro-wrestler/
Apr 11, 2023 - Belligerent self-promotion could be his downfall
the mythpro wrestlingtrumpunherd
https://www.newstatesman.com/politics/uk-politics/2020/02/myth-public-viewing-gallery-how-londons-skyscrapers-bargain-our-space
It was the receptionist who finally told the truth. "There is no public viewing space here," said the bemused concierge, when I asked him the way to the...
the mythpublic viewinglondon sgallery
https://www.bonappetit.com/story/healthyish-podcast-episode-1
Jun 17, 2021 - On the first episode of the "Healthyish" podcast, we talk about how the past year changed the way we think about our health.
the mythhealthy eatingchristinavanessa
https://truthout.org/video/copaganda-perpetuates-the-myth-that-freedom-puts-the-public-in-danger/
Sep 18, 2023 - Even as violent crime decreased in the U.S., media coverage of crime increased.
the mythcopagandafreedomputspublic
https://thegivingblock.com/resources/myth-vs-fact-should-crypto-investors-just-donate-cash/
Feb 17, 2023 - There are many benefits to choosing to donate crypto rather than cash. Here's a breakdown of the top reasons and how both donors and nonprofits benefit.
mythvsfactcryptoinvestors
https://sobrief.com/books/the-myth-of-normal
8 Takeaways: 1) Trauma shapes our health, personality, and society 2) The mind-body connection is fundamental to well-being 3) Early experiences profoundly...
the mythnormalsummaryquotesfaq
https://camsparty.com/about-us
There have been tales of CamsParty in the early sagas of the viking explorers. When you need some epic cams, you chose CamsParty!
the storyuscamspartybehindmyth
https://brideandgroomtoday.com/haitian-women/
Screen for heightened risk individual and entities globally to help uncover hidden risks in business relationships and human networks. The US government and...
the biggesthaitian womenmythexposedcom
https://www.carrickryan.com/post/2018/04/15/the-defence-against-tyranny-myth
The population needs guns as a defence against a tyrannical government. This is why the Second Amendment was implemented. This is why it remains in place....
the defencetyrannymyth
https://seehimfuck.com/trailers/HIM-JOHNNY-D-GOOD-BTS.html
Aries stud phenom Johnny D Good gets the full See HIM Fuck treatment in this no-limits scene with tall Hannah Quinn. After a quick post-interview chat...
cam kingbtsdommaintainingmyth
https://www.fox5dc.com/video/610715
DC Mayor Muriel Bowser launched FlipTheScript, which is a positive visual campaign aimed at dispelling the myth of the absent black father.
the mythvisualcampaign
https://theconversation.com/woodward-and-bernstein-didnt-bring-down-a-president-in-watergate-but-the-myth-that-they-did-lives-on-183290
Washington Post reporters Carl Bernstein and Bob Woodward broke stories about the Watergate scandal that helped unravel Richard Nixon’s presidency. But they...
woodward and bernsteinbringpresidentwatergate
https://www.indigo.ca/en-ca/of-myth-and-men-the-white-night-volume-i-the-good-the-evil-variant-cover/9781998079001.html
Buy the book Of Myth and Men: The White Night: Volume I (The Good, The Evil, variant cover) by francesco coscarella at Indigo
the white nightmythmenvolume
https://frontrowreviewers.com/?p=26468
Jul 7, 2025 - By Jason and Alisha Hagey In Western Minerals & Their Origins, memory doesn’t follow a straight road. It cuts and winds through a canyon full of
footpaththeatrewesternmineralsamp
https://mediamythalert.com/2015/04/16/katharine-graham-the-economist-and-bringing-down-nixon/
With a bit of routine fact-checking, news organizations usually can sidestep the embarrassment of trading in prominent media myths. But, no: The narrative...
katharine grahameconomistbringingnixon
https://nextcloud.com/blog/press_releases/nextcloud-launches-hub-10-breaking-the-myth-of-european-tech-dependency/
May 28, 2025 - Nextcloud launches Hub 10 – the latest version of its private cloud collaboration platform that rivals Big Tech solutions, introducing the first open source...
the mythnextcloudlauncheshubbreaking
https://www.niskanencenter.org/why-we-can-safely-let-incarceration-drop/
Sep 19, 2025 - The biggest hint that the incarceration decline can safely continue is that it has been consistently paired with declining recidivism rates.
the mythniskanen centeroptimallevelincarceration
https://mediamythalert.com/2010/02/26/recalling-the-mythical-cronkite-moment/
“It is one of the great stories American journalism tells about itself, a moment when the power of television was trained on foreign policy to make a...
mythicalcronkitemomentmediaalert
https://www.goodreads.com/book/show/211003829-the-good-mother-myth
Read 296 reviews from the world’s largest community for readers. Timely and thought-provoking, Nancy Reddy unpacks and debunks the bad ideas that have for …
the good motherbad ideasmythunlearning
https://truthout.org/articles/the-thanksgiving-myth-hides-the-uss-inability-to-reckon-with-its-own-history/
Nov 28, 2025 - “I’m not against giving thanks. I’m against celebrating a falsehood,” says Choctaw historian A. S. Dillingham.
thanksgivingmythhidesinabilityreckon
https://heritageage.com/the-27-day-lie-and-the-myth-of-the-clean-slate-7541/
The Unspoken Truth of Sustained Recovery The ridges of the bronze coin are digging into the soft meat of my palm, leaving a temporary, serrated scar that looks...
dayliemythclean
https://washingtonstand.com/article/national-myth-and-the-lesson-of-thanksgiving
Historian Michael Gannon contended that the first Thanksgiving occurred over 50 years prior, in what is today St. Augustine, Florida, while others argue that th
national myththe lessonthanksgiving
https://www.nationalreview.com/corner/elizabeth-warren-and-the-myth-of-momentum/
Warren enters the first Democratic debate hoping to capitalize on some recent good headlines. But is momentum all that important?
elizabeth warrenthe mythnational reviewmomentum
https://greek-myth.fandom.com/wiki/Clash_of_the_Titans_2010
In ancient times, after defeating their predecessors, the Titans, the gods divided the Universe among themselves. Zeus took the skies, Poseidon took the seas,...
the titansgreek mythclashwikiafandom
https://www.refinery29.com/en-au/2022/03/10902196/french-girl-style-myth-dead
If we really want to be more like French women when it comes to style, the perfect red lipstick and LBD will only get us so far. The most enviable thing about...
the frenchis deadgirlstylemyth
https://www.ohjoysextoy.com/sex-myth/
Oh Joy Sex Toy thinks the world of sex is amazing. Using comics, comedy and research, this curated weekly sex-positive webcomic covers all kinds of topics with...
sex toythe mythohjoy
https://www.notebookcheck.net/Black-Myth-Wukong-Our-benchmarks-of-the-new-Unreal-Engine-5-game.876868.0.html
We put the Black Myth: Wukong benchmark to the test using a variety of laptop and desktop GPUs.
black myth wukongthe newunreal enginebenchmarks
https://betzeapk.com/kronos.html
Discover the riveting gameplay, features, and strategies of Kronos, the immersive online game capturing players' imagination worldwide.
an epic journeyphloginunveilingkronos
https://data.bnf.fr/temp-work/870e40427c43921ce2e445f24704f147/
Toutes les informations de la Bibliotheque Nationale de France sur : The King and the clown in Southern Indian myth and poetry - David Dean Shulman
the kingsouthern indianclownmyth
https://nielseniq.com/global/en/insights/analysis/2020/do-belgians-believe-in-the-myth-of-the-green-consumer/
Do Belgians still believe in making an impact through individual actions or do they hold accountable major organizations for the climate issues?
believe inthe mythbelgiansgreenconsumer
https://www.newyorker.com/magazine/2018/10/29/the-myth-of-whiteness-in-classical-sculpture
Oct 22, 2018 - Margaret Talbot on the suppressed truth that Greek and Roman statues were often painted, and the scholars who are making a color correction.
the mythclassical sculpturenew yorkerwhiteness
https://greekmythcomix.com/comic/deaths-in-the-iliad-a-classics-infographic/
As requested: buy this as a poster in the UK! Or buy this as a poster in the US! (original version) NEW: go here to find out exactly how useless Paris is!
in thegreek mythdeathsiliadclassics
https://www.econlib.org/archives/2011/10/the_myth_of_the_6.html?to_print=true
Russ Roberts continues to engage with Tyler Cowen on whether there has been stagnation. A lot of the argument is over what has happened to the median worker....
the mythmedianworkereconlib
https://chacruna.net/soma-and-the-sacred-feminine-reflections-from-ancient-vedic-myth/
Soma, Vedic God of Plants, and soma, the ancient psychedelic drink made from an unknown plant, both represent the sacred feminine.
sacred feminineancient indiansomareflectionsmyth
https://good-good.fireside.fm/133
Golf's road to the Paralympics was dealt another setback last week when the IPC announced it was one of the sports not admitted into the 2028 Games in Los...
the goodgolfpodcastepman
https://engage.drugpolicy.org/secure/tell-san-diego-sheriff-retract-debunked-fentanyl-myth
Sign the petition and fight back against dangerous misinformation.
the santelldiegosheriffretract
https://www.instructure.com/webinar/lms-migration-mythbusting
Join us to uncover the real story behind LMS migration and hear why one district chose Canvas to support their needs and how they made a smooth, successful...
myth bustingthe truthmigrationswitchinglms
https://www.thestranger.com/visual-art/2013/02/13/15995245/charles-krafft-is-a-white-nationalist-who-believes-the-holocaust-is-a-deliberately-exaggerated-myth/comments/177
Comments on What Should We Make of Artist Charles Krafft (and His Work) Now That His Views on the Holocaust Are Not a Secret?
charles krafftwhite nationalistthe holocaustbelieves
https://www.nowtolove.co.nz/fashion-beauty/essano-collagen-boost-range/
Nov 21, 2025 - We turn to an expert to help us separate fact from fiction when it comes to how this protein powerhouse works in skincare.
through thecuttingcollagenhypeseparating
https://stories.as.com/en/amp/the-myth-of-the-werewolf-from-antiquity-to-the-present-day?utm_source=amp_socy
In Greece and Rome, there were already tales of men transforming into wolves, and during the Renaissance, they became a plague in the collective imagination
the mythwerewolfantiquitypresent
https://nio.tips/myth-of-multitasking/
Multitasking is often hailed as the ultimate productivity hack. It seems like everyone is juggling multiple tasks at once, aiming to master all in less time.
the mythdoing itholding youmultitasking
https://taxjustice.net/reports/the-millionaire-exodus-myth/
Jun 24, 2025 - A millionaire exodus widely reported by news outlets around the world, and credited for the UK Labour government’s decision to weaken tax reforms, did not...
tax justice networkthe millionaireexodusmyth
https://www.birmingham.ac.uk/news-archive/2018/calling-time-on-the-myth-of-burrators-underwater-village
The legend of the 'hidden village', claimed to be finally emerging from the depths of Burrator Reservoir on Dartmoor due to this year's hot summer...
calling timeon themythburratorunderwater
https://thestrongwilledchild.substack.com/p/the-myth-of-christian-community
Why Making Friends After Evangelicalism Feels Impossible
the mythchristian community
https://reliableremediation.com/stop-the-fog/
Mold fogging sounds easy, but it rarely works. Learn why Eastern CT mold experts recommend true mold removal based on national standards and how to protect...
the fogmold remediationeastern ctstopexperts
https://tubedupe.com/video/228095/the-man-the-myth-the-girth/
TiaMarie hears around the office that her new boss, Girthmaster, has a HUGE dick! Apparently, his third arm has caused a little drama in the workplace amongst...
the manporno moviesmythgirthtiamaria
https://melmagazine.com/en-us/story/the-myth-of-the-mutual-breakup
If press releases are to be believed, all breakups are mutual. Recent exhibit: Lena Dunham and her boyfriend of five years Jack Antonoff have apparently...
the mythmutualbreakup
https://www.skeptic.com/michael-shermer-show/the-myth-of-human-exceptionalism-why-humans-arent-as-special-as-we-think/
About this episode: In this episode, Harvard primatologist Christine Webb challenges one of our deepest beliefs: that humans stand apart from the rest of...
the mythhuman exceptionalismhumansspecial
https://www.stir.ac.uk/research/hub/publication/1000126
Newspaper Article: Penman MA (2018) Bruce Almighty: the man, the myth and the legend of King Robert. 09.09.2018.
newspaper articlebruce almightythe manmyth
https://www.ottplay.com/features/dharmendra-the-star-who-finished-his-arc-early-let-the-myth-stand-alone/5290632ed0487
Nov 24, 2025 - Long before the action-hero silhouette calcified around him, Dharmendra was the quietly magnetic presence at the centre of some of Hindi cinema’s
the stardharmendrafinishedarcearly
https://www.meetup.com/sf-philosophy-reading-group/events/312504257/?eventOrigin=city_most_popular_event
For this session, we take on Wittgenstein’s *Philosophical Investigations* (Sections 1–33 and 191–360). Wittgenstein doesn't try to solve...
language gameswittgensteinampprivatemyth
https://www.dogoodbusiness.net/post/the-myth-of-capitalism-monopolies-and-the-death-of-competition-jonathan-tepper-and-denise-hearn
"The Myth of Capitalism" is a highly accessible presentation of the problems associated with increasing oligarchy in the United States of America. It is...
the mythcapitalismmonopoliesdeathcompetition
https://newrepublic.com/article/203097/los-angeles-weather-rains-flood-fire
For over a century, the city has drawn people with the promise of perfect weather. Now floods and fires threaten its very survival.
climate changethe mythlos angeleskilling
https://www.psychologytoday.com/ca/blog/the-addiction-connection/201708/the-myth-of-motivation
So many of us wait to feel motivated before we do anything. But what we don't realize is that just by taking action, the motivation will follow.
the mythpsychology todaymotivationcanada
https://www.middleeasteye.net/big-story/gaza-israel-7-october-destroyed-myth-military-invincibility
To its allies and enemies, Israel's disastrous response to the Hamas attack has undermined its future as regional hegemon and even its very survival
war on gazathe mythoctoberforeverdestroyed
https://www.thestranger.com/visual-art/2013/02/13/15995245/charles-krafft-is-a-white-nationalist-who-believes-the-holocaust-is-a-deliberately-exaggerated-myth/comments/175
Comments on What Should We Make of Artist Charles Krafft (and His Work) Now That His Views on the Holocaust Are Not a Secret?
charles krafftwhite nationalistthe holocaustbelieves
https://www.sparknotes.com/philosophy/sisyphus/section11/
A summary of The Myth of Sisyphus in Albert Camus's The Myth of Sisyphus. Learn exactly what happened in this chapter, scene, or section of The Myth of...
myth of sisyphussummaryanalysis
https://mediamythalert.com/2014/05/29/exaggerating-the-power-of-napalm-girl-photo/
“Napalm girl” was an unsettling image, undeniably memorable. But it does not follow that it wielded immeasurable or decisive influence.
the powernapalm girlexaggeratingphotomedia
https://www.slashgear.com/study-on-santa-claus-finds-most-kids-pretend-to-believe-the-myth-14557996/?fbclid=IwAR3ROOMKB5IhiBFERFfPX_JWA57t505mJYLsWBKYsEheL9NUMOScJaKiL04
In our The Handmaid's Tale Baggage review, we examine what may very well be the cruelest episode of Hulu's very cruel series yet.
santa clausto believestudyfindskids
https://predatordefense.org/agencies/index.htm
Predator Defense is working to stop America's war on wildlife and reform state and federal wildlife management agencies. They kill millions of wild animals...
the killingpredatordefenseagenciesunmasking
https://millercenter.org/issues-policy/us-domestic-policy/the-hundred-days-myth
A rookie president, entering office with as much goodwill as he (or she) is ever likely to enjoy, has room to maneuver and opportunities to act that seldom...
the hundred daysmiller centermyth
https://brazzporn.com/the-man-the-myth-the-girth-tiamaria-girthmasterr/
Tiamaria, Girthmasterr TiaMarie hears around the office that her new boss, Girthmaster, has a HUGE dick! Apparently, his third arm has caused a little drama in...
the manmythgirthtiamaria
https://theaviationist.com/2025/03/10/f-35-kill-switch-myth/
Mar 11, 2025 - With heightened tensions between Europe and the United States over NATO and Ukraine, the myth of an F-35 "kill switch", which would supposedly allow...
the fkill switchseparatingmyth
https://www.clubhouse.com/room/M8XyknlL?utm_medium=ch_room_xerc&utm_campaign=658Gka4TvhtAEj8Pb0__Cw-496675
You were invited to join this live room
gene keysthe alchemistjoinmyth
https://www.bain.com/ko/insights/truth-behind-myth-of-the-lone-entrepreneur-wsj/
Other entrepreneurs are one of the best resources for startup know-how and funding.
surprisingtruthbehindmythlone
https://www.lemonde.fr/en/opinion/article/2025/12/26/the-myth-of-european-censorship-is-wielded-by-the-trump-administration-to-avoid-regulating-big-tech_6748855_23.html
OP-ED. In an op-ed for Le Monde, researchers Stefania Di Stefano and Garance Denner argue that American accusations of censorship against Europe are a...
the mytheuropeancensorshiptrump
https://tribune.com.pk/story/1999400/myth-of-the-saviour
Democratic systems are about compromises, and they are about constitutional values
the saviourmyth
https://www.mintel.com/insights/events/how-to-target-the-real-gen-z-not-the-myth/
Experienced food and drink thinker, Jonny Forsyth, looks at what Gen Z really prioritizes from food and drink brands, and how this understanding can drive...
how tothe realgen ztargetmyth
https://www.theatlantic.com/ideas/archive/2025/06/gen-z-red-wave/683212/
Jun 20, 2025 - The best available evidence suggests that the youth-vote shift in 2024 was more a one-off event than an ideological realignment.
the mythgen zred waveatlantic
https://theconversation.com/the-model-minority-myth-hides-the-racist-and-sexist-violence-experienced-by-asian-women-157667
The invisibility of anti-Asian racism is inextricably connected to the model minority myth, which serves to disguise the violence experienced by Asian American...
model minority mythsexist violencehidesracist
https://www.damnsgiven.com/the-myth-of-ai-inevitability/
We are being told everywhere that a world soaked in AI where algorithms and LLMs are the essential conduits for human experience. And we are told TINA - there...
the mythaiinevitability
https://omny.fm/shows/six-hats/the-fat-myth-zoe-harcombe-on-what-we-got-wrong-about-fat
In this eye-opening episode of SIX Hats, Dr. Shami sits down with nutrition researcher and myth-buster Zoe Harcombe, PhD to unpack one of the most...
the fatmythzoeharcombegot
https://speakerdeck.com/eileencodes/the-myth-of-the-modular-monolith-day-2-keynote-rails-world-2024
Sep 27, 2024 - As Rails applications grow over time and turn into a so-called “ball of mud”, organizations ask themselves what’s next? Should we stay the course with...
the mythmodularmonolithdaykeynote
https://www.forrester.com/report/The-Myth-Of-A-World-After-A-European-Recovery-Perspective/RES161489?objectid=RES161489
Expectations of a world after the coronavirus and a next normal have been exaggerated. Human nature shows us that bad habits often overcome good intentions....
the mythworld aftereuropeanrecoveryperspective
https://www.globalsign.com/en/podcast/too-small-to-hack-busting-the-myth-sarah-armstrong-smith
Sarah Armstrong-Smith, Chief Security Advisor at Microsoft, discusses the cyber threats facing SMEs and how they can protect themselves.
too smallthe mythhackbustingputting
https://www.koreaherald.com/article/10646951
The Year of the Fire Horse has dawned. The horse -- the seventh of the 12 animals in the Chinese zodiac -- is known for its agility, muscular strength and resil
push backstrongmarriagehorsesign
https://fextralife.com/larian-breaks-the-myth-you-dont-need-past-divinity-games-to-enjoy-the-new-one/
Never played Divinity before? Larian reassures fans that the new game is a perfect entry point for newcomers.
the mythlarianbreaksneedpast