Robuta

https://slides.com/karlho/workshop_isdsagml_unsupervised/fullscreen ISDSA Workshop: Gentle Introduction to Machine Learning -Unsupervised Learning 3/4 ISDSA Workshop: Gentle Introduction to Machine Learning - Unsupervised Learning machine learningworkshopgentleintroductionunsupervised https://en.wikipedia.org/wiki/Unsupervised_learning Unsupervised learning - Wikipedia unsupervised learningwikipedia https://arxiv.org/abs/1503.03585 [1503.03585] Deep Unsupervised Learning using Nonequilibrium Thermodynamics Abstract page for arXiv paper 1503.03585: Deep Unsupervised Learning using Nonequilibrium Thermodynamics unsupervised learningdeepusingthermodynamics https://researchportal.ip-paris.fr/fr/publications/unsupervised-motion-retargeting-for-human-robot-imitation/ Unsupervised Motion Retargeting for Human-Robot Imitation - Institut Polytechnique de Paris for humanunsupervisedmotionretargeting https://arxiv.org/abs/2204.02973 [2204.02973] Incremental Unsupervised Feature Selection for Dynamic Incomplete Multi-view Data Abstract page for arXiv paper 2204.02973: Incremental Unsupervised Feature Selection for Dynamic Incomplete Multi-view Data feature selection https://www.isca-archive.org/interspeech_2010/haidar10_interspeech.html ISCA Archive - Novel weighting scheme for unsupervised language model adaptation using latent... https://www.isca-archive.org/interspeech_2018/riad18_interspeech.html ISCA Archive - Sampling Strategies in Siamese Networks for Unsupervised Speech Representation... iscaarchivesamplingstrategies https://www.aiacceleratorinstitute.com/supervised-vs-unsupervised-learning-101-key-differences-and-applications/ Supervised vs. unsupervised learning 101: Key differences and applications Mar 14, 2025 - We will explore the concepts of supervised and unsupervised learning and highlight their key differences. unsupervised learningkey differencesvsapplications https://researchconnect.stonybrook.edu/en/publications/prior-knowledge-guided-vision-transformer-based-unsupervised-doma/ Prior knowledge-guided vision-transformer-based unsupervised domain adaptation for intubation... prior knowledgedomain adaptationguidedvisiontransformer https://www.sri.com/publication/information-computer-science-pubs/unsupervised-learning-of-discriminative-edge-measures-for-vehicle-matching-between-non-overlapping-cameras/ Unsupervised Learning of Discriminative Edge Measures for Vehicle Matching Between Non-Overlapping... Mar 10, 2023 - This paper proposes a method for matching road vehicles between two non-overlapping cameras. unsupervised learning https://unsupervised.ca/2020/11/25/9567/ Unsupervised Design May 22, 2021 - Choosing to not go play hockey tonight hours before the rink is closed for a few weeks is probably one of the toughest calls I have had to make in 2020. At the... unsuperviseddesign https://doisrpska.nub.rs/index.php/electronics/article/view/7390 A Novel Unsupervised Approach for Land Classification Based on Touzi Scattering Vector Model in the... https://www.ijcai.org/proceedings/2018/702 Unsupervised Learning based Jump-Diffusion Process for Object Tracking in Video Surveillance | IJCAI Electronic proceedings of IJCAI 2018 https://bytez.com/docs/arxiv/1811.11226/paper CT organ segmentation using GPU data augmentation, unsupervised labels and IOU loss | Read Paper on... Nov 27, 2018 - Fully-convolutional neural networks have achieved superior performance in a variety of image segmentation tasks. However, their training requires laborious... https://aaai-2022.virtualchair.net/poster_aaai8081 AAAI2022: Unsupervised Sentence Representation via Contrastive Learning with Mixing Negatives contrastive learningunsupervisedsentencerepresentationvia https://dukespace.lib.duke.edu/items/1bb82226-107a-45cd-83e4-841b57f4df46/full Robust and scalable unsupervised learning via landmark diffusion, from theory to medical application https://euranova.eu/nl/insights/innovate-ai-augment-to-interpret-unsupervised-and-inherently-interpretable-graph-embeddings Augment to Interpret: Unsupervised and Inherently Interpretable Graph Embeddings | Euranova In this paper, we study graph representation learning and show that data augmentation that preserves semantics can be learned and used to produce... augmentinterpretunsupervisedgraphembeddings https://teslamagz.com/news/tesla-reaches-musks-10-billion-mile-data-goal-for-unsupervised-driving/ Tesla reaches Musk's 10 billion mile data goal for unsupervised driving - TeslaMagz May 3, 2026 - Tesla owners have now driven 10 billion miles using the company's supervised Full Self-Driving software. This milestone arrived just five... https://rcc.uchicago.edu/content/unsupervised-learning-computer-vision-0 Unsupervised Learning in Computer Vision | Research Computing Center Unsupervised Learning in Computer Vision Unsupervised learning methods are becoming increasingly important as the field of computer vision evolves. Without... computer vision researchunsupervised learningcomputingcenter https://pure.psu.edu/en/publications/unsupervised-learning-of-object-features-from-video-sequences/fingerprints/ Unsupervised learning of object features from video sequences - Fingerprint - Penn State unsupervised learningobjectfeatures https://pure.nwpu.edu.cn/en/publications/behavior-contrastive-learning-for-unsupervised-skill-discovery/ Behavior Contrastive Learning for Unsupervised Skill Discovery - Northwestern Polytechnical... contrastive learningskill discoverybehaviorunsupervisednorthwestern https://www.irejournals.com/paper-details/1715054 A Two-Stage Generative Model for Unsupervised Brain Tumor Detection Using CycleGAN and Diffusion... A Two-Stage Generative Model for Unsupervised Brain Tumor Detection Using CycleGAN and Diffusion Models. IRE Journals. https://emitter.pens.ac.id/index.php/emitter/article/view/477 Unsupervised Twitter Sentiment Analysis on The Revision of Indonesian Code Law and the... twitter sentiment analysison the https://proceedings.neurips.cc/paper_files/paper/2012/hash/47a658229eb2368a99f1d032c8848542-Abstract.html The topographic unsupervised learning of natural sounds in the auditory cortex unsupervised learningnatural soundstopographicauditorycortex https://blog.techiescamp.com/docs/unsupervised-machine-learning/ Unsupervised Machine learning Feb 3, 2025 - Learn about Unsupervised Machine Learning, including clustering, association rule mining, and dimensionality reduction with real-world examples! unsupervisedmachinelearning https://lpi.tel.uva.es/node/223 Unsupervised 4D myocardium segmentation with a Markov Random Field based deformable model |... with a https://researchportal.port.ac.uk/en/publications/email-reply-prediction-unsupervised-leaning-approach/fingerprints/ Email reply prediction: unsupervised leaning approach - Fingerprint - University of Portsmouth university ofemailreplypredictionunsupervised https://publikationen.uni-tuebingen.de/xmlui/handle/10900/125517 Position statement on classification of basal cell carcinomas. Part 1: unsupervised clustering of... position statementbasal cell https://www.bio-conferences.org/articles/bioconf/abs/2024/48/bioconf_emc2024_13002/bioconf_emc2024_13002.html Unsupervised Deep Learning approach for image registration in Correlative Microscopy for the... BIO Web of Conferences, open access proceedings in biology, life sciences and health deep learningfor imageunsupervisedapproach https://stax.strath.ac.uk/concern/theses/f7623d11b?locale=en Thesis | Unsupervised data-driven analysis of ultrasonic inspection data | ID: f7623d11b | STAX Unsupervised data-driven analysis of ultrasonic inspection data data driven analysisultrasonic inspectionthesisunsupervised https://unsupervised.ca/2011/01/17/8858/ Unsupervised Design unsuperviseddesign https://mdooai.com/en/learn/ml/mlSupervisedUnsupervisedSelf Supervised, Unsupervised, and Self-Supervised Learning | Basic Machine Learning | Learn Machine learning is often divided into **supervised**, **unsupervised**, and **self-supervised** learning depending on how data is used. **Supervised... self learningsupervisedbasicmachine https://pure.ug.edu.gh/en/publications/factors-associated-with-adherence-to-the-unsupervised-daily-dose--2/ Factors associated with adherence to the unsupervised daily dose of seasonal malaria... associated withto the https://researchr.org/publication/TangXC24-0/related Doubly stochastic subdomain mining with sample reweighting for unsupervised domain adaptive person... https://arxiv.org/abs/2406.15751 [2406.15751] Improving Unsupervised Clean-to-Rendered Guitar Tone Transformation Using GANs and... Abstract page for arXiv paper 2406.15751: Improving Unsupervised Clean-to-Rendered Guitar Tone Transformation Using GANs and Integrated Unaligned Clean Data https://www.isca-archive.org/interspeech_2011/siu11_interspeech.html ISCA Archive - Unsupervised audio patterns discovery using HMM-based self-organized units https://www.catalyzex.com/paper/unsupervised-video-summarization Unsupervised Video Summarization Unsupervised Video Summarization: Paper and Code. This paper introduces a new, unsupervised method for automatic video summarization using ideas from... unsupervisedvideosummarization https://www.thejournal.club/c/paper/391786/ Unsupervised Lightweight Single Object Tracking with UHP-SOT++ object trackingunsupervisedlightweightsingleuhp https://en12.zlibrary.to/dl/supervised-and-unsupervised-pattern-recognition-feature-extraction-and-computational-intelligence Supervised and Unsupervised Pattern Recognition: Feature Extraction and Computational Intelligence... pattern recognitionfeature extractionsupervisedcomputationalintelligence https://www.unsupervised.com/examples/hhs-medicaid Example - Medicaid Spending Analysis | Unsupervised Representative output from Unsupervised analytics technology showing how pattern discovery turns Medicaid spending data into source-backed findings and open... examplemedicaidspendinganalysisunsupervised https://www.fh-dortmund.de/publikationen/fis.import.pub.de.3073.php Physics-based surge point identification for unsupervised CFD-computation of centrifugal compressor... https://wvvw.easychair.org/publications/keyword/lg22 Keyword: Unsupervised Data Augmentation keywordunsuperviseddataaugmentation https://scholars.lib.ntu.edu.tw/entities/publication/1540e9e4-3d07-4968-8b5a-30ca0a24fe79 REBORN: Reinforcement-Learned Boundary Segmentation with Iterative Training for Unsupervised ASR rebornreinforcementlearnedboundarysegmentation https://publications-cnrc.canada.ca/eng/view/object/?id=4d9b7d7b-55bd-4bc3-ae96-c77327300154 Unsupervised hierarchical image segmentation with level set and additive operator splitting - NRC... Unsupervised hierarchical image segmentation with level set and additive operator splitting image segmentationlevel set https://www.nubileporn.net/moms-teach-sex-brandi-love-and-lily-larimar-i-left-my-stepson-unsupervised/ Moms Teach Sex - Brandi Love and Lily Larimar I Left My Stepson Unsupervised I Left My Stepson Unsupervised with this sexy hot tits and big ass milf Brandi Love having her best friend's daughter Lily Larimar staying with her when her... moms teach sex https://sbcserv.com/article/adelaide-childcare-centre-closed-7-incidents-of-unsupervised-children Adelaide Childcare Centre Closed: 7 Incidents of Unsupervised Children (2026) May 21, 2026 - Childcare Safety Crisis: A Wake-Up Call for Parents and Authorities The recent closure of an Adelaide childcare center, Edge Early Learning, due to multiple... childcare centreadelaideclosedincidentsunsupervised https://www.nubileporn.net/de/moms-teach-sex-brandi-love-and-lily-larimar-i-left-my-stepson-unsupervised/ Moms Teach Sex - Brandi Love and Lily Larimar I Left My Stepson Unsupervised I Left My Stepson Unsupervised with this sexy hot tits and big ass milf Brandi Love having her best friend's daughter Lily Larimar staying with her when her... moms teach sex https://ieeetv.ieee.org/ondemand/ieee-isbi-2020-virtual-conference-april-2020/2863/adversarialbased-domain-adaptation-networks-for-unsupervised-tumour-detection-in-histopathology Adversarial-Based Domain Adaptation Networks for Unsupervised Tumour Detection in Histopathology |... Developing effective deep learning models for histopathology applications is challenging, as the performance depends on large amounts of labelled training... domain adaptationadversarialbasednetworks https://papers.cool/venue/11926@AAAI An Unsupervised Model With Attention Autoencoders for Question Retrieval | Cool Papers - Immersive... Question retrieval is a crucial subtask for community question answering. Previous research focus on supervised models which depend heavily on training data... https://www.sun-xr-project.eu/segmentcodelist-unsupervised-representation-learning-for-human-skeleton-data-retrieval/ SegmentCodeList: Unsupervised Representation Learning for Human Skeleton Data Retrieval | SUN representation learningfor humandata retrievalunsupervisedskeleton https://amitness.com/posts/keyword-extraction Unsupervised Keyphrase Extraction Learn about unsupervised algorithms for automatically extracting representative keyword and phrases from documents unsupervisedkeyphraseextraction https://openreview.net/forum?id=wctboDvy9f¬eId=wctboDvy9f Unsupervised Feature Extraction from a Foundation Model Zoo for Cell Similarity Search in... Acquiring high-quality datasets in medical and biological research is costly and labor-intensive. Traditional supervised learning requires extensive labeled... https://google.github.io/tacotron/publications/global_style_tokens/ Audio samples from "Style Tokens: Unsupervised Style Modeling, Control and Transfer in End-to-End... https://unsupervised.ca/2012/04/15/8401/ Unsupervised Design May 22, 2021 - getting help editing a film unsuperviseddesign https://www.drivendata.org/competitions/217/cdc-fall-narratives/ Competition: Unsupervised Wisdom: Explore Medical Narratives on Older Adult Falls Data science competition for social good: Unsupervised Wisdom: Explore Medical Narratives on Older Adult Falls. Join now and compete! explore medicalolder adultcompetitionunsupervisedwisdom https://ecommons.udayton.edu/graduate_theses/7059/ "Pathological image analysis with supervised and unsupervised deep lear" by Mst Shamima Nasrin Artificial intelligence (AI) based analysis is accelerating clinical diagnosis from pathological images and automating image analysis efficiently and... https://www.corruption.news/2026-03-02-records-reveal-systemic-failures-minnesota-daycare-oversight.html Unsupervised and overbilled: Records reveal systemic failures in Minnesota daycare oversight A public records release reveals systemic billing fraud, safety violations and lax oversight at multiple Minneapolis-area daycare centers. State investigators... systemic failuresin minnesotaunsupervisedrecordsreveal https://www.brainblendai.com/blogs/the-real-cost-of-unsupervised-ai-coding The Real Cost of Unsupervised AI Coding - BrainBlend AI Apr 10, 2026 - AI coding tools promise to ship features while your team sleeps. The data tells a different story: inflated confidence, hidden vulnerabilities, and technical... the real costai codingunsupervised https://www.clubfreetime.com/new-york-city-nyc/free-play/2026-05-02/event/732895 NYC, 05/02/2026, 2:00PM. UNSUPERVISED AND UNRULY: Comedy on Adolescence. NYC, May 2 2026, 2:00PM. UNSUPERVISED AND UNRULY: Comedy on Adolescence. New York City https://huggingface.co/papers/2412.15216 Paper page - UIP2P: Unsupervised Instruction-based Image Editing via Cycle Edit Consistency Join the discussion on this paper page paper page https://blog.skyloop.cloud/what-are-supervised-and-unsupervised-ai-learning-methods/ What are Supervised and Unsupervised AI Learning Methods? - Skyloop AI Nov 17, 2025 - Artificial intelligence sounds complex, but at its heart it is about how computers learn from data. Two of the most important learning styles are supervised... what areai learningsupervisedmethodsskyloop https://earpods.store/blind-trust-the-reality-behind-tesla-s-unsupervised-robotaxi Blind Trust: Tesla's Unsupervised Robotaxis & Safety Apr 18, 2026 - A hard-nosed look at what unsupervised Tesla robotaxis mean for rider safety, regulation, and consumer rights. blind trustteslaunsupervisedrobotaxissafety https://uwaterloo.ca/data-systems-group/references/enhancing-sparse-retrieval-unsupervised-learning-0 Enhancing Sparse Retrieval via Unsupervised Learning | Data Systems Group | University of Waterloo unsupervised learning https://openreview.net/forum?id=YnFuUX08CE Unsupervised Evaluation of Code LLMs with Round-Trip Correctness | OpenReview To evaluate code large language models (LLMs), research has relied on a few small manually curated benchmarks, such as HumanEval and MBPP, which represent a... round tripunsupervisedevaluationcodellms https://deepai.org/publication/towards-principled-unsupervised-learning Towards Principled Unsupervised Learning | DeepAI Nov 19, 2015 - 11/19/15 - General unsupervised learning is a long-standing conceptual problem in machine learning. Supervised learning is successful because... unsupervised learningtowardsprincipleddeepai https://theses.ubn.ru.nl/items/9114d995-dc37-4068-bb5d-5b92cd8ace7f Investigating temporal coding in high-dimensional neuronal ensembles by unsupervised clustering of... https://uu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A1744128&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all HiddenMarkovModelReaders : A Julia implementation of a Hidden Markov Model and unsupervised... hidden markov modeljuliaimplementationunsupervised https://cris.fbk.eu/handle/11582/311816 Unsupervised Spike Sorting for Large-Scale, High-Density Multielectrode Arrays large scalehigh densityunsupervisedspikesorting https://turcomat.org/index.php/turkbilmat/article/view/10537 A Study on Unsupervised Learning Algorithms Analysis in Machine Learning | Turkish Journal of... a studyunsupervised learning https://aclanthology.org/P15-2082/ Unsupervised Decomposition of a Multi-Author Document Based on Naive-Bayesian Model - ACL Anthology Khaled Aldebei, Xiangjian He, Jie Yang. Proceedings of the 53rd Annual Meeting of the Association for Computational Linguistics and the 7th International Joint... https://researchconnect.stonybrook.edu/en/publications/simple-unsupervised-summarization-by-contextual-matching/ Simple unsupervised summarization by contextual matching - Stony Brook University stony brooksimpleunsupervisedsummarizationcontextual https://proceedings.iclr.cc/paper_files/paper/2024/hash/1d41343cf93afd6456db3d1820ce1a58-Abstract-Conference.html Copilot4D: Learning Unsupervised World Models for Autonomous Driving via Discrete Diffusion world modelsautonomous drivinglearningunsupervised https://ijirt.org/article?manuscript=143761 Research Paper on Unsupervised Stemmer for Kannada Language | IJIRT.org apply for ugc care approved... Explore the article titled Unsupervised Stemmer for Kannada Language from IJIRT Volume 3, Issue 1. This study evaluates the effectiveness of teaching programs... https://theanswershome.com/week-3-unsupervised-learning-techniques/ Week 3 - Unsupervised learning techniques - Theanswershome Oct 30, 2024 - the nuts and bolts of machine learning coursera week 3 quiz answers - Unsupervised learning techniques unsupervised learningweektechniques https://www.per-central.org/items/similar.cfm?ID=15151 Materials Similar to Unsupervised quantitative methods to analyze student reasoning lines:... similar toquantitative methodsmaterialsunsupervisedanalyze https://dinamicaego.com/dokuwiki/doku.php?id=unsupervised_classification unsupervised_classification [Dinamica EGO] unsupervisedclassificationdinamicaego https://unsupervisedlearning.libsyn.com/website/category/general Razib Khan's Unsupervised Learning Razib Khan engages a diverse array of thinkers on all topics under the sun. Genetics, history, and politics. See: http://razib.substack.com/ razib khanunsupervisedlearning https://unsupervised.ca/2011/04/24/8799/ Unsupervised Design unsuperviseddesign https://xrayinterpreter.com/paper/doi/10.1109/JBHI.2026.3687961 RetinexDA: Progressive Disentanglement Domain Adaptation for Unsupervised Cross-Modality Medical... Deep neural networks have achieved strong performance in medical image segmentation when the training and testing data share similar appearance charac domain adaptationprogressivedisentanglementunsupervisedcross https://rivm.openrepository.com/entities/publication/eab2cc3a-2625-476f-b95b-2f9c17cecfbb Diagnostic accuracy of covid-19 rapid antigen tests with unsupervised self-sampling in people with... During phase 1, 45.0% (n=279) of participants in the Flowflex group, 29.1% (n=239) in the MPBio group, and 35.4% ((n=257) in the Clinitest group were... https://www.ijcai.org/proceedings/2022/176 Learning Degradation Uncertainty for Unsupervised Real-world Image Super-resolution | IJCAI Electronic proceedings of IJCAI 2022 real worldsuper resolutionlearningdegradationuncertainty https://www.dmove.it/news/tesla-espande-il-suo-servizio-robotaxi-unsupervised-a-huston-e-dallas Tesla espande il suo servizio Robotaxi "unsupervised" a | DMove.it DMove.it (Digital Move) è il magazine sulla mobilità innovativa, tecnologica e smart. Un punto di riferimento per capire e prevedere come l teslailsuoserviziorobotaxi https://www.iris.sssup.it/handle/11382/375451 Unsupervised Greedy Learning of Finite Mixture Models unsupervisedgreedylearningfinitemixture https://publications.slu.se/?file=publ/show&id=42976 Unsupervised classification of single-particle X-ray diffraction snapshots by spectral clustering |... Single-particle experiments using X-ray Free Electron Lasers produce more than 10(5) snapshots per hour, consisting of an admixture of blank shots (n x ray diffraction https://unsupervised.ca/2017/07/11/8219/ Unsupervised Design unsuperviseddesign https://lrec.elra.info/lrec2022-main-042 Out of Thin Air: Is Zero-Shot Cross-Lingual Keyword Detection Better Than Unsupervised? - LREC 2022... Jun 1, 2022 - Keyword extraction is the task of retrieving words that are essential to the content of a given document. Researchers proposed various approaches to tackle this https://omny.fm/shows/unsupervised-learning/unsupervised-learning-no-60/embed Unsupervised Learning: No. 60 unsupervised learning https://ricerca.unich.it/handle/11564/700483 Supervised and Unsupervised Hate Speech Detection hate speechsuperviseddetection https://journals.plos.org/ploscompbiol/article?id=10.1371/journal.pcbi.1006173 Unsupervised extraction of epidemic syndromes from participatory influenza surveillance... Author summary This study suggests how web-based surveillance data can provide an epidemiological signal capable of detecting the temporal trends of... unsupervisedextractionepidemicsyndromesparticipatory https://esc365.escardio.org/presentation/200709 ESC 365 - Unsupervised one-class classification and anomaly detection of stress echocardiograms... https://papers.nips.cc/paper_files/paper/2018/hash/398475c83b47075e8897a083e97eb9f0-Abstract.html Unsupervised Text Style Transfer using Language Models as Discriminators text stylelanguage modelsunsupervisedtransferusing https://unofficialnetworks.com/2026/04/23/parents-felony-chairlift-fall/ Parents Charged With Felony After Their Unsupervised Kid Falls Off Chairlift - Unofficial Networks Apr 23, 2026 - Following a twenty-foot fall from a chairlift, the kid's parents are facing felony charges for him being unsupervised. https://www.thelasttech.com/ai/what-is-unsupervised-feature-learning-in-machine-learning What is Unsupervised Feature Learning? Learn what unsupervised feature learning in machine learning is, how it works, and why it helps improve data analysis without labeled data. what isunsupervisedfeaturelearning https://awesome.ecosyste.ms/lists?topic=unsupervised-learning Awesome unsupervised-learning Lists | Ecosyste.ms: Awesome A curated list of awesome lists for every topic, language and framework. unsupervised learningawesomelistsms https://themarkfoundation.org/published_research/end-to-end-robust-joint-unsupervised-image-alignment-and-clustering/ End-to-end robust joint unsupervised image alignment and clustering | The Mark Foundation for... Jan 31, 2023 - Zeng X, Howe G, Xu M. End-to-end robust joint unsupervised image alignment and clustering. Proc IEEE Int Conf Comput Vis. 2022. https://unsupervisedlearning.libsyn.com/2024/05 Razib Khan's Unsupervised Learning Razib Khan engages a diverse array of thinkers on all topics under the sun. Genetics, history, and politics. See: http://razib.substack.com/ razib khanunsupervisedlearning https://www.preprints.org/manuscript/202505.2124 Moving Toward Unsupervised Construction Management: An Automated Construction Worker Efficiency... In the Architecture, Engineering, and Construction (AEC) industry, traditional labor efficiency evaluation methods have limitations, while computer vision... construction managementmovingtowardunsupervisedautomated https://liner.com/review/unsupervised-induction-semantic-roles-within-reconstructionerror-minimization-framework Unsupervised Induction of Semantic Roles within a Reconstruction-Error Minimization Framework... Regarding this NAACL 2014 paper, this review summarizes an unsupervised framework for inducing semantic roles by minimizing reconstruction errors. unsupervisedinductionsemanticroles https://unsupervised.ca/2012/09/14/8347/ Unsupervised Design unsuperviseddesign https://www.entandaudiologynews.com/reviews/journal-reviews/post/measuring-is-understanding-an-unsupervised-prom-clustering-of-crs-patients Measuring is understanding: an unsupervised PROM clustering of CRS patients | ENT & Audiology News