https://www.digitalstormmarketing.com/
Website Design and Web Services - Digital Storm Marketing
web services digitaldesignstormmarketing
https://www.pilloni.it/
pilloni.it – Web Services & Digital Marketing
web services digitalmarketing
https://fpdigital.io/
Expert Web Services & Digital Solutions | Fp Digital Agency
web services digitalexpertsolutionsfpagency
https://visualwebz.com/
Seattle SEO Web Services & Digital Marketing for Businesses
web services digitalseattleseomarketingbusinesses
https://jconlinesolutions.com/
JC Online Solutions — Top Web Services & Digital Strategies
Elevate your digital presence with JC Online Solutions. We provide comprehensive web services, SEO, content creation, and modern digital strategies to grow...
web services digitalonline solutionsjctopstrategies
https://www.namirial.com/en/sign/signing-web-services/
eSigning Web Services | Digital Signature API | Namirial.com
Namirial Signing Web Services deliver scalable API-based digital signature capabilities that integrate seamlessly into existing business systems. Leveraging
web services digitalesigningsignatureapinamirial
https://www.levelupwebservices.com/
Level Up! Web Services - Digital Marketing | Web Designers
Digital marketing solutions for businesses and brands. From Web Design, SEO, PPC advertising, and more, get more clients today!
web services digitallevelmarketingdesigners
https://digitalquake.ae/
Website Design Agency in Dubai | Professional Web Design Services - Digital Quake
Digital Quake is the leading-edge web design agency in Dubai. Our expert web designers can create visually stunning and captivating websites for brands and...
professional web servicesdesign agencydubaidigitalquake
https://jediwebservices.com/
JEDI WEB SERVICES | Digital Marketing, SEO, & Design
web services digitalmarketing seojedidesign
https://nirvanweb.in/
Nirvan Web Services | Digital Growth Powered by Tomorrow's Tech
We help businesses and creators grow online using high-performance websites, modern design, intelligent search optimization, and AI-powered marketing.
web services digitalgrowth poweredtomorrowtech
https://www.ironistic.com/
Digital Marketing & Web Development Services | Ironistic
Nov 27, 2023 - Creative digital marketing, web design, and web development services. Over 75+ years combined experience. Improve your impact with Ironistic.
digital marketing webdevelopment servicesironistic
https://www.gozoek.com/
Zoek: #1 Wix Digital Marketing Agency, SEO, Web Design & Development Services - Zoek Marketing
Zoek is the #1 growth marketing agency offering small business website design, SEO, social media marketing, online marketing tools, and white label services....
digital marketing agencyseo web designzoekwixdevelopment
https://gaugedigitalmedia.com/
#1 Digital Marketing For Home Services | SEO, PPC, Web Design
Apr 17, 2026 - Grow your home service company with Gauge Digital. Stop buying shared leads. Have us build your exclusive lead machine. Contact us today!
services seo ppcdigital marketingwebdesign
https://thirteen05.com/
Web Design and Digital Marketing Services - thirteen05 creative
Jan 28, 2026 - thirteen05 creative is a full-service web design and digital marketing agency that builds world-class websites and delivers SEO results.
digital marketing servicesweb designcreative
https://www.piiperdigitalsolutions.com/
Piiper Digital Solutions | Home | Web Design & SEO Services
Piiper specializes in keeping our clients ahead of the competition through Increased Visibility, improved SEO Strategies, and executive Web Design services.
web design seodigital solutionsservices
https://www.myoptimind.com/
Digital Agency Services Philippines | SEO, Social, Web & Mobile
May 14, 2026 - Optimind is a digital marketing agency based in Manila, Philippines. Our expertise covers SEO, Social Media, Digital Advertising, and Web and Mobile app...
digital agency servicesseo socialphilippineswebmobile
https://infostreamusa.com/
Web Design & Digital Marketing Services | InfoStream Solutions
Jul 10, 2024 - InfoStream Solutions is a web design and digital marketing company that helps companies and organizations develop and enhance their online brands.
web design digitalmarketing servicesinfostreamsolutions
https://oscwebdesign.biz/
Custom Web Design, Development & Digital Marketing Services: Maine Web Design & Marketing | OSC Web...
Feb 17, 2025 - Are you ready to take your business to the next level? Good, because that's what we're here to help you do. Using our digital design and marketing expertise,...
custom web designdevelopment digital marketingservicesmaineosc
https://www.tenpine.ca/
Niagara Web Design and Digital Marketing Services | Tenpine
Need a website? We are a leading Niagara web design company offering digital marketing, hosting, domain registration, SEO, logo design and more.
digital marketing servicesweb designniagara
https://www.allianceinteractive.com/
Web Design, Digital Marketing Agency & Website Maintenance Services
web design digitalmarketing agencymaintenanceservices
https://biggerfishmarketing.com/
Digital Marketing Agency Woodbridge | Web Development Services | Local SEO
digital marketing agencyweb development serviceswoodbridgelocalseo
https://www.envisionup.com/
Digital Marketing Agency Canada - SEO, Web Design, PPC Services
Jan 29, 2026 - Save time and Money. Experts in Home Services Marketing, B2B Services and Charities and Associations. Certified Google Partner.
digital marketing agencyseo web designcanadappcservices
https://www.csdesignstudios.com/
Tucson Digital Marketing Agency - Web Design and SEO Services
Jun 26, 2025 - CS Design Studios is the trusted digital marketing company delivering exceptional SEO, Web Design and Social Media in Tucson. Call 520-908-6088.
digital marketing agencyweb designtucsonseoservices
https://wheelhorsedigital.com/
Wheel Horse Digital | Springfield MA Web Design, SEO & Digital Marketing Services
Website design, SEO and sales funnel/email marketing services for small local businesses in Western Massachusetts
web design seohorse digitalwheelspringfieldmarketing
https://www.tseg.com/
Law Firm Digital Marketing | Legal Web Design Services
May 6, 2026 - Let TSEG run your Law Firm's digital marketing campaign. We offer web design, SEO and PPC services for law firms nationwide. Contact us to get started!
law firm digitalmarketing legalweb designservices
https://samanthadigital.com/
Web Design & SEO Services for Small Business | Samantha Digital
Jan 31, 2026 - Looking for a digital marketing agency in Virginia, Northern VA, Washington DC, or Maryland? Look no further than Samantha Digital LLC for...
web design seosmall businessservicessamanthadigital
https://web-seo1.com/
Digital Marketing Services & Web Designing in Florida | SEO
digital marketing servicesweb designingfloridaseo
https://www.bluetonemedia.com/
Local Web Design & Digital Marketing Agency | Expert SEO Services | Wilmington NC - BlueTone Media...
BlueTone Media offers expert web design and internet marketing services in Wilmington NC. Our solutions include SEO, PPC, custom WordPress designs, and more....
local web designdigital marketing agencyexpert seo serviceswilmingtonbluetone
https://ioweb.my/
Web Design, Digital Marketing Services - Innovative Web Solutions for Businesses in Malaysia
Jun 20, 2025 - IOWEB.my offers cutting-edge web design, development, and digital solutions tailored for Malaysian businesses. Empower your online presence with professional...
web design digitalmarketing servicesinnovative solutionsbusinessesmalaysia
https://www.tdtrg.com/
Web Design, Development and Digital Marketing Services in NY
May 15, 2026 - Digi Tech Resources Group: Your Partner in Custom Websites, Mobile Apps, Digital Marketing, SEO, PPC, and Social Media Optimization Services.
web design developmentdigital marketing servicesny
https://www.rumahmedia.com/
RUMAH MEDIA: Web Design Bali | Digital Agency | SEO Services
We are Bali web developer, web design, SEO services, digital marketing agency, online course, mobile developer that will help create value for your business.
media web designdigital agency seorumahbaliservices
https://benworldwide.com/
Digital Solutions Company | Web, Software & AI Services
Apr 17, 2026 - A digital solutions company crafting websites, mobile apps, AI experiences, and immersive AR/VR services for businesses across industries.
digital solutions companyweb softwareaiservices
https://www.mesdac.com/
Digital Marketing Services| Web Application Development Company in Oman
Transform your online presence with stunning digital marketing services in Oman that capture your brand's essence. We have an experienced team of web...
digital marketing servicesweb application developmentcompanyoman
https://www.elevateom.com/
UK Digital Marketing Services & Web Design | ElevateOM
uk digital marketingservices web design
https://p8dmc.com/
Top Digital Marketing Agency in Bucks County PA, Web Design, SEO, PPC Services - Planet 8 Digital
top digital marketingbucks county paweb design seoppc servicesagency
https://advdms.com/
SEO & Web Development - Advanced Digital Media Services
Mar 31, 2026 - At Advanced Digital Media Services, we apply the latest software and cutting-edge practices to give our clients verifiable results.
seo web developmentadvanced digitalmediaservices
https://www.interxmedia.co.uk/
interXmedia – Internet, Web & Digital Media Services
web digital mediainternetservices
https://www.justintimellc.net/
Just-in-Time Digital Marketing | Web Design & Digital Marketing Services in Connecticut
Grow your business with Just-in-Time Digital Marketing. We specialize in web design, SEO, branding, and digital marketing services tailored for small...
digital marketing webdesign servicestimeconnecticut
https://www.ssftech.co.uk/
Professional Web, Design & IT Services UK | Your Digital Growth Partner
professional web designservices ukdigital growthpartner
https://adwortise.com/
Adwortise | Digital Marketing & Web Development Services
Mar 25, 2026 - Discover Adwortise's expert digital marketing and web development services. Tailored solutions to enhance your brand, drive traffic, and boost conversions!
digital marketing webdevelopmentservices
https://www.pixelarmy.ca/
Edmonton Web Design and Digital Marketing Services| Pixel Army
Edmonton Web Design, SEO and Digital Marketing services. Over 20 Years of high-performing responsive websites.
edmonton web designdigital marketing servicespixelarmy
https://www.digitalotters.com/
Digital Otters | Web Development, SEO, AI Ranking & Cloud Services
May 15, 2026 - Digital Otters is a global digital agency providing web development, SEO, AI ranking solutions, cloud services, digital marketing and paid ads management to...
web development seoai rankingdigitalotterscloud
https://ibridge.digital/
iBridge Digital Hyderabad | Best Digital Marketing Services | Web Development Company
May 19, 2025 - With over years of experience across multiple industries iBridge Digital is a one-stop solution for Digital Marketing Services. Grow your business with...
marketing services webhyderabad bestibridgedigitaldevelopment
https://roboticsysinfo.com/
Best Digital Marketing Services | Best Web Development Company in Karnal
best digital marketingservices web developmentcompanykarnal
https://www.agencyjet.com/
Digital Marketing Agency: Affordable SEO, PPC & Web Design and Development Services | Agency Jet
Agency Jet is a full-service digital marketing agency with 6 offices nationwide. We provide expert online marketing services including SEO, pay per click, and...
digital marketing agencyseo ppc webdevelopment servicesaffordabledesign
https://www.idhlagency.com/
Integrated Digital Marketing Agency & Web Services | UK & USA | IDHL
IDHL is a digital agency combining strategy, technology and marketing to help ambitious brands drive sustainable, long‑term growth.
integrated digital marketingagency webservices ukusaidhl
https://canberrafc.com/
Digital Agency Services – Web Design, Development & Marketing | Canberrafc
Professional digital agency services by Canberrafc. We offer web design, development, branding and PPC marketing to help your business grow and succeed online.
digital agency servicesweb design developmentmarketing
https://www.marswebsolution.com/
Web Design & Digital Marketing Services | Mars Web Solution
Boost your online presence with Mars Web Solution! Expert web design and SEO services to enhance your business. Let's conquer the digital realm together. 🚀
web design digitalmarketing servicesmarssolution
https://voilamediagroup.com/
Voila Media Group | Digital Marketing Solutions and Web Design Services
Mar 9, 2026 - Voila Media Group is a leading provider of digital marketing solutions and web design services. We help businesses establish a strong online presence, drive...
media group digitalmarketing solutionsweb designvoilaservices
https://jpswebdesigns.com/
Web Design Services & Digital Marketing Fresno, CA - JP Solutions
web design servicesdigital marketingfresno cajpsolutions
https://risevisible.com/
Leaders In Web Design | SEO | Digital Marketing Services | Rise Visible
Feb 12, 2026 - Rise Visible is a Boise-based web design, SEO, and marketing agency with 27+ years of experience helping businesses grow online.
web design seodigital marketing servicesleadersrisevisible
https://humble.agency/
Humble Agency | Web Development & Digital Marketing Services
Humble Digital Agency brings expertise to the areas you need most: web development, app development, email marketing, and CRO.
agency web developmentdigital marketinghumbleservices
https://salterrasite.com/
Salterra Digital Services, SEO and Web Design
Salterra Digital Services delivers WordPress web design, SEO, and growth services for medical and home service businesses nationwide. Book an audit.
digital services seowebdesign
https://www.enetwebservices.com/
Web Design, SEO and Digital Marketing Company - eNet Web Services
web design seodigital marketing companyenetservices
https://www.sproutmedialab.com/
Digital Marketing Agency Raleigh, Orlando, Daytona | SEO Company & Web Design Services Raleigh NC
digital marketing agencyseo company webdesign servicesraleighorlando
https://dfwwebsiteseo.com/
Dallas Digital Marketing Agency: SEO, PPC & Web Design Services
dallas digital marketingagency seo ppcweb designservices
https://onecallwebdesign.com/
One-Call Web Design & Digital Marketing Services
web design digitalone callmarketingservices
https://generation-web.com/
Generation Web - Results-oriented digital marketing services that you can count on.
Generation Web provides design, development, SEO, SEM, hosting, maintenance, and security services you can count on.
oriented digital marketinggeneration webresultsservicescount
https://www.c2-com.com/
Public Relations Agency Naples FL, Digital Marketing Services, Branding, Digital Advertising, Web...
public relations agencydigital marketing servicesnaples flbranding advertisingweb
https://www.the-web-guys.com/
The Web Guys | Digital Marketing & Website Design Services
Mar 2, 2026 - The Web Guys is a service-driven digital marketing firm in Carmel, IN. Call us at (317) 805-4933 to learn more.
digital marketingwebguysdesignservices
https://www.blumac.digital/
Bespoke Software Development UK | Web, Mobile & IT Services | Blumac Digital
Blumac Digital builds bespoke web applications, mobile apps and integrated business software for UK SMEs. Custom Laravel development, managed AWS hosting,...
bespoke software developmentuk webmobileservicesdigital
https://orqadesign.com/
Web Design & Development, HTML Email, Graphic Design, Digital Design & Branding Services in Malvern...
Orqa Design provides creative design and web services from Malvern, Worcestershire, working with clients locally and around the world. They specialise in...
web design developmenthtml emailgraphic digitalbranding servicesmalvern
https://10design.gr/
Web design & Digital Services by 10 DESIGN - Anargyros Dekavallas
web design digitalservices
https://www.quantumcloud.com/
Digital Agency for Web, Mobile App Development & WordPress Services
web mobile appdigital agencydevelopment wordpressservices
https://jsmtmedia.com/
JSMT Media | Custom Web Design & Digital Marketing Services
custom web designdigital marketingmediaservices
https://www.kitemedia.com/
Kite Media Digital Marketing & Web Design Services in Logan, Utah
media digital marketingweb design serviceskiteloganutah
https://www.waterscapetech.com/
SMART Web Design & Digital Marketing Services-WaterscapeTech
smart web designdigital marketing services
https://clearcutdigital.com/
New Hampshire Web Designer | Web Design Services | Manchester, NH | Clear Cut Digital
new hampshireweb designerservices manchesterclear cutnh
https://www.kyberdigital.co.uk/services
Web Design & Digital Marketing Agency Northern Ireland | Kyber Digital | Our Services
We are the go-to digital agency for delivering complex technical strategiesYou dont need to change your business to match our technology
web design digitalmarketing agency northernirelandkyberservices
https://aknetworksolutions.com/online-reputation-management-services-orm/
Online Reputation Management Services (ORM) | Web Design & Development, Digital Marketing & Data...
online reputation managementweb design developmentdigital marketingservicesorm
https://helium-seo.com/web-design-digital-marketing-agency/
Web Design Digital Marketing Agency - SEO Services - Helium SEO
Nov 11, 2025 - Say goodbye to complex marketing jargon and hello to straightforward, effective marketing that fills your calendar with Web design jobs. Helium isn’t a vendor....
web design digitalmarketing agency seoserviceshelium
https://aknetworksolutions.com/best-bing-ppc-services-a-complete-guide/
Best Bing PPC Services: A Complete Guide for 2025 - Web Design & Development, Digital Marketing &...
Aug 2, 2025 - Best Bing PPC Services: A Complete Guide for 2025 While Google Ads dominates the PPC landscape, Bing PPC services—powered by Microsoft Advertising—offer unique...
web design developmentbing ppccomplete guidebestservices
https://devacademy.la/
Dev Academy | Best IT Solutions Company for Web, App & Digital Services
Jul 8, 2025 - Discover Dev Academy – your trusted IT solutions partner for custom web development, mobile apps, digital marketing, and expert consulting. Scalable, smart,...
web app digitalacademy bestsolutions companydevservices
https://www.coderzvisiontech.com/
Our Services | Software, App, Web Development, Digital Marketing
Leading IT solutions company.
app web developmentservices softwaredigitalmarketing
https://xlncdigital.com/services/
Services | Brand Identity, Web Design, Digital Marketing & App Development
We specialize in web design, digital marketing, branding, and content creation, with a passion for helping small businesses grow through transparency and...
brand identity webdesign digital marketingservicesappdevelopment
https://davezdesignz.com/
Web Design, SEO, & Digital Marketing | David Downey Professional Services
Apr 29, 2026 - Professional web design, development, SEO, and digital marketing by David Downey. Over 30 years of experience delivering fast, custom, and results-driven...
web design seodigital marketingdaviddowneyprofessional
https://algotechnology.us/
Algo Technology - Web Design & Digital Marketing Services in USA
technology web designdigital marketing servicesalgousa
https://www.aimedwebsolutions.com/
Web Designing Company in Hyderabad | Digital Marketing Services
Web Designing Company in Hyderabad offers Website Development, Design Services and Digital Marketing Services, SEO Services in India.
web designing companyhyderabad digital marketingservices
https://www.fyin.com/services/
Digital Services (Web Development and more!)
Get variety of digital services from our talented experts at FYIN! From web development and UI/UX Design to digital marketing, we've got it all!
services web developmentdigital
https://etechnocraft.com/
Digital Marketing Agency SEO Services, PPC, Web Design, Web Development | eTechnoCraft Internet...
digital marketing agencyseo services ppcweb design developmentinternet