Robuta

https://www.ecoteam.lk/ Eco Team Sri Lanka | Sustainable Wildlife and Adventure Tours Experience Sri Lanka with Eco Team: sustainable wildlife safaris, adventure tours, eco-lodges, and cultural journeys. Pioneering responsible travel since 2000 eco teamsri lankasustainablewildlifeadventure https://primatesofpanama.org/ Home - Primates of Panama | Wildlife Conservation & Research Projects wildlife conservationprimatespanamaresearchprojects https://sabuklodge.com/ Home - Sabuk Lodge | Safari, Nature & Luxury Wildlife Retreat Sep 28, 2025 - Welcome to Sabuk Lodge, a sanctuary where nature, comfort, and culture meet in harmony. Tucked away from the fast pace of modern life, Sabuk Lodge offers... lodge safarinature luxurysabukwildliferetreat https://www.fws.gov/ U.S. Fish and Wildlife Service | U.S. Fish & Wildlife Service fish and wildlifeuservice https://pwrillinois.com/ Wildlife Removal Services Plano, IL | PWR Illinois wildlife removal servicesplanopwrillinois https://myfwc.com/ Florida Fish and Wildlife Conservation Commission | FWC Managing fish and wildlife resources for their long-term well-being and the benefit of people. fish and wildlifeconservation commissionfloridafwc https://ugandawildlife.org/ Uganda Wildlife Authority - UWA uganda wildlife authorityuwa https://www.rspb.org.uk/ RSPB Bird & Wildlife Conservation Charity wildlife conservationrspbbirdcharity https://www.wildlifetrusts.org/ Home | The Wildlife Trusts The Wildlife Trusts is a federation of 47 independent wildlife conservation charities covering the UK, Alderney and the Isle of Man. We manage nature reserves,... the wildlifetrusts https://www.kabinivacations.net/ Kabini Tour Packages - Wildlife amidst Scenic Paradise Kabini Tour Packages offers tours to wildlife destination amid great scenic paradise to give you a blissful experience. Book your holidays at Kabini Vacations kabini tour packageswildlifeamidstscenicparadise https://www.bestpestcontrolsheridan.com/ Best Pest Control Sheridan Wyoming | Wildlife Control Services best pest controlsheridanwyomingwildlifeservices https://nbwildliferanchtx.com/ nbwildliferanchtx.com - Texas Wildlife Domain Discover nbwildliferanchtx.com, a premium domain for wildlife ranches in Texas. texas wildlifedomain https://www.shamrockpestmanagement.ca/ Shamrock Pest Management Services - Wildlife Removal Services & Exterminator including Mosquito &... Shamrock Pest Management Services is a family-owned business in the area of Grand Bend Ontario, providing a broad variety of services ranging from residential... shamrock pest managementwildlife removalservicesexterminatorincluding https://mountainsandmist.com/ Mountains and Mist Wildlife and Nature Art, Photography and Workshops Mountains and Mist - Wildlife Art, Nature Art, Nature Photography and Workshops mountains and mistnature artwildlifephotographyworkshops https://dnpwc.gov.np/ Department of National Parks and Wildlife Conservation Barbarmahal Powered by GIWMS | DOIT national parks and wildlifedepartment ofconservation https://ugandawildlifetours.com/ Home - Top Budget & Eco-friendly Uganda Wildlife Tours 2025 Apr 10, 2026 - Home: Discover tailored tours, budget and luxury options, and unforgettable experiences in the Pearl of Africa. Plan your Uganda safari today! uganda wildlife tourshome topeco friendlybudget https://www.ecowice.org/ Homepage - Environmental Conservation for Wildlife and Community Enterprise Jul 15, 2026 - Experience a thrilling start with generous welcome bonuses and ongoing promotions at 1win, enhanced by regular cashback offers, making every bet more rewarding... environmental conservationhomepagewildlifecommunityenterprise https://tpwd.texas.gov/ Texas Parks & Wildlife Department TPWD.Texas.gov is the place to find information about Texas state parks, hunting, fishing, licenses, wildlife, Game Wardens, boat registration and more. texas parkswildlifedepartment https://www.outdoorguide.com/ Outdoor Guide - For Those Who Live Outside: Safety, Wildlife, Tips, Gardening, & Travel Outdoor Guide will help you live your best life outside - from wildlife guides, to safety information, gardening tips, and more. outdoor guidelive outside https://www.hiwwt.org.uk/ Hampshire & Isle of Wight Wildlife Trust | Hampshire and Isle of Wight Wildlife Trust isle of wightwildlife trusthampshire https://bajaex.com/ Whale Watching. Ocean Safaris. Extraordinary Wildlife. | Baja Expeditions whale watchingoceansafarisextraordinarywildlife https://www.nwf.org/ National Wildlife Federation Uniting all Americans to ensure wildlife thrive in a rapidly changing world, the National Wildlife Federation builds upon our nation's conservation heritage... national wildlifefederation https://www.sheldrickwildlifetrust.org/ Sheldrick Wildlife Trust: Haven for Elephants & Rhinos Pioneers in the rescue and hand-raising of orphaned baby elephants and rhinos, through to their reintegration to the wild when grown. Saving wild lives today... sheldrick wildlife trustelephantsrhinos https://scottishwildlifetrust.org.uk/ Scottish Wildlife Trust - Scotland's leading nature conservation charity Jul 13, 2026 - Find out about the latest news, project updates, events and opportunities with the Scottish Wildlife Trust, Scotland's leading nature conservation charity. scottish wildlife trustnature conservationscotlandleadingcharity https://manitobahabitattrust.com/ Manitoba Habitat Trust | Conservation & Wildlife Preservation Manitoba Habitat Trust - Protecting and preserving Manitoba's natural habitats and wildlife through conservation, restoration, and education initiatives. manitobahabitattrustconservationwildlife https://wildlife.ca.gov/ California Department of Fish and Wildlife Home Page The Department of Fish and Wildlife manages California's diverse fish, wildlife, and plant resources, and the habitats upon which they depend, for their... fish and wildlifedepartment ofcalifornia https://bronxzoo.com/ Saving Wildlife and Wild Places - Bronx Zoo General information, zoo history, map, education program summary, animal photos and descriptions, and calendar of events. Part of The Wildlife Conservation... saving wildlifeplacesbronxzoo https://fwegb.gov.pk/ Home - Forest, Wildlife & Environment Department Government of Gilgit-Baltistan Illegal Timber Smuggling foiled at Dambodas Forest Check Post Chief Secretary Gilgit-Baltistan Visited Forest Park Skardu A cleanliness campaign was carried... forest wildlifeenvironment departmentgovernmentgilgitbaltistan https://www.plantbiologic.com/ Food Plot Seed for Deer, Turkey, and Wildlife | Plant BioLogic Plant BioLogic has changed the way gamekeepers manage their herds and properties. Find high quality food plot seed for deer, turkey, and other wildlife here! food plot seeddeerturkeywildlifeplant https://uwec.ug/ Uganda Wildlife Conservation Education Centre – entebbe zoo uganda wildlifeconservation educationcentreentebbezoo https://www.nativnurseries.com/ Mossy Oak Nativ Nurseries - Oak Trees and Fruit Trees for Wildlife Mossy Oak Nativ Nurseries is dedicated to growing the country's best seedlings and plants for nature enthusiasts, wildlife and habitat managers. Shop our... mossy oaknativ nurseriestreesfruitwildlife https://www.outdoorphotographymagazine.co.uk/ Outdoor Photography Magazine: Landscape | wildlife | nature | adventure Jul 7, 2026 - Outdoor Photography is the UK’s leading magazine dedicated to landscape, wildlife, nature, travel and adventure. Ideal for photographers of all levels. outdoor photography magazinelandscapewildlifenatureadventure https://wdfw.wa.gov/ Home | Washington Department of Fish & Wildlife The Washington Department of Fish and Wildlife is dedicated to preserving, protecting, and perpetuating the state’s fish, wildlife, and ecosystems department ofwashingtonfishwildlife https://animalswildfacts.com/ Animals Wild Facts – Discover Amazing Animal Facts, Lists & Wildlife Guides May 30, 2026 - Discover amazing animal facts, wildlife guides, and detailed species lists on Animals Wild Facts. Explore habitats, behaviors, and fun facts about animals... animals wildfactsdiscoveramazinglists https://www.maine.gov/ifw/ Maine Dept of Inland Fisheries and Wildlife mainedeptinlandfisherieswildlife https://hebnaturenotes.org/ Hebridean Nature Notes, Outer Hebrides wildlife & landscapes Dec 5, 2025 - Hebridean Nature Notes, observations and reflections of local naturalists on the wildlife and landscapes of the islands of the Outer Hebrides. hebridean nature notesouter hebrideswildlifelandscapes https://www.tpwf.org/ Texas Parks and Wildlife Foundation - Home Oct 8, 2025 - Texas Parks and Wildlife Foundation leverages public funds with private philanthropy to create lasting changes in how TPWD stewards our natural resources. texas parks and wildlifefoundation https://dwr.virginia.gov/ Virginia Department of Wildlife Resources (DWR) Virginia DWR is responsible for the management of inland fisheries, wildlife, and recreational boating for the Commonwealth of Virginia. department ofwildlife resourcesvirginiadwr https://currumbinsanctuary.com.au/ Gold Coast's #1 Attraction | Currumbin Wildlife Sanctuary Jul 13, 2026 - Experience Currumbin Wildlife Sanctuary on the Gold Coast! Encounter amazing wildlife, exciting shows, and fun family experiences. gold coastattractioncurrumbinwildlifesanctuary https://defenders.org/ Defenders of Wildlife Defenders of Wildlife works on the ground, in the courts, and on Capitol Hill to protect and restore imperiled wildlife and habitats across North America.... defenderswildlife https://www.waghobaecolodge.com/ Wildlife Lodges in Tadoba | Luxury Resorts in Tadoba Waghoba Eco Lodge is a sustainable luxury resort in Tadoba National Park with a luxury pool, lounge and spacious cottages. wildlifelodgestadobaluxuryresorts https://www.africanaturalsafaris.com/ Africa Natural Safaris – Safari Company for Wildlife African Safaris for 2026 - 2027 Plan 5000+ African wildlife safaris from $200 for 2026 - 2027 with Africa Natural Safaris, a safari-focused booking Company for Tanzania, Kenya, Uganda, and... safari companyafricanaturalsafaris https://denverzoo.org/ Denver Zoo Conservation Alliance | Saving Wildlife Together Jul 28, 2026 - Your visit supports our wildlife conservation efforts in Colorado + worldwide denver zooconservation alliancesaving wildlifetogether https://www.tigersafariindia.co.uk/ Tiger Safari India: Best Tiger Safari & Wildlife Tours 2026 Apr 16, 2026 - Best Tiger Safari India: Experience seamless tiger safaris in India with expert naturalists, premium hotels and in the popular national parks of India. tiger safari indiawildlife toursbest https://coastwildlife.org/ Wildlife Center Of The North Coast • WCNC May 30, 2026 - WCNC is a non-profit, licensed wildlife rehabilitation and conservation education center located in Astoria, OR serving the north Oregon Coast. the north coastwildlife centerwcnc https://mogowildlifepark.com.au/ Home - Mogo Wildlife Park Jul 9, 2026 - Get closer to Australian Animals in their habitats at Featherdale Sydney Wildlife Park. Pat a koala and experience the largest collection of Australian animals... mogowildlifepark https://www.cheaprwandasafaris.com/ Cheap Rwanda Safaris: Budget Gorilla Trekking & Wildlife safaris Oct 28, 2025 - Cheap Rwanda safaris offer budget gorilla trekking and wildlife safaris in Rwanda, budget Rwanda safaris are an option for visiting Rwanda. budget gorilla trekkingrwanda safarischeapwildlife https://www.naturesafariindia.com/ Best Tiger Safari in India: Book Wildlife Safari Tours 2026 best tiger safari in indiawildlife toursbook https://www.africawildlifesafaris.net/ Africa Wildlife Safaris - Africa Vacation Holiday Tours Feb 5, 2026 - Africa wildlife safaris with Wildhorn Africa. Explore top safari destinations, from the Big Five to gorilla trekking, with tailor-made itineraries, africa wildlife safarisvacationholidaytours https://www.wlf.louisiana.gov/page/recreational-fishing-licenses-and-permits Recreational Fishing Licenses and Permits | Louisiana Department of Wildlife and Fisheries Louisiana Department of Wildlife and Fisheries recreational fishing license and permit information licenses and permitsrecreational fishingdepartment oflouisianawildlife https://nwf.org/ National Wildlife Federation Uniting all Americans to ensure wildlife thrive in a rapidly changing world, the National Wildlife Federation builds upon our nation's conservation heritage... national wildlifefederation https://www.wcs.org/ Saving Wildlife and Wild Places - WCS.org The Wildlife Conservation Society saves wildlife and wild places worldwide through science, conservation action, education, and inspiring people to value... saving wildlifeplaceswcs https://www.wires.org.au/ WIRES - Wildlife Information Rescue and Education Service Support WIRES in rescuing and rehabilitating Australia's wildlife. Your donation helps provide critical emergency response and resources for native animals in... wildlife informationwiresrescueeducationservice https://www.fws.gov/program/sport-fish-restoration Sport Fish Restoration | U.S. Fish & Wildlife Service The Sport Fish Restoration Program was created in 1950 to restore and better manage America's declining fish resources. sport fish restorationuwildlifeservice https://www.bornfree.org.uk/ We Are Born Free - Since 1984 we have worked tirelessly for the conservation of wildlife and... https://sdzwildlifeexplorers.org/ Home | San Diego Zoo Wildlife Explorers san diego zoowildlifeexplorers https://www.tourism.go.ug/ Tourism Uganda | Ministry of Tourism Wildlife and Antiquities | Kampala Official Site for the Ministry of Tourism, Wildlife and Antiquities. MTWA tourismugandaministrywildlifeantiquities https://www.highlandwildlifepark.org.uk/ Welcome to Highland Wildlife Park | Highland Wildlife Park Embark on a wild adventure at Highland Wildlife Park. Encounter amazing animals, support conservation, and explore the Scottish Highlands. welcome tohighlandwildlifepark https://mossyoakgamekeeper.com/ Mossy Oak Gamekeeper | Join in Conservation of Land, Habitat & Wildlife Jul 1, 2026 - Mossy Oak Gamekeeper is the ultimate source for wildlife management and conservation. Videos, articles, podcasts and more. Become a member. mossy oakjoin ingamekeeperconservationland https://brevardzoo.org/ Brevard Zoo - We Share Our Joy of Nature to Help Wildlife and People Thrive. Feb 23, 2026 - There's so much to experience at Brevard Zoo. Our lush, open-air habitats are home to over 900+ animals from around the world! Take your Zoo visit to the next... https://pelorusfoundation.org/ Pelorus Foundation | Protecting Wildlife and Wild Places Jun 30, 2026 - Pelorus Foundation is an independent charity that empowers individuals and local communities to preserve and protect the world’s wildlife and wild places for... pelorus foundationprotecting wildlifeplaces https://www.topafricasafari.com/ Top Africa Safari | Best Wildlife African Safaris in Tanzania, Kenya, Uganda & Rwanda (2026 - 2027) Compare top African safari packages with Top Africa Safari, operated by Africa Natural Tours. Discover wildlife safaris in Tanzania, Kenya, Uganda, and Rwanda... top africa safari https://oh-web.s3licensing.com/ Wildlife Home Ohio Division of Wildlife homepage wildlife https://www.wildlife-picchio.com/ Picchio: Wildlife Research, Conservation and Eco-Tours in Japan Nov 26, 2024 - Picchio is a wildlife research center and NPO, based in Japan's Nagano region with a presence in Hokkaido's Shiretoko region and Okinawa's Iriomote area.... wildlife researcheco tourspicchioconservationjapan https://vtfishandwildlife.com/ Home | Vermont Fish & Wildlife Department vermontfishwildlifedepartment https://www.hawaiiwildlifediscoverycenter.org/ Hawaiʻi Wildlife Discovery Center on Maui wildlife discovery centermaui https://www.tourism.go.ke/ Ministry of Tourism and Wildlife Our Wildlife Our Places Tour Kenya Our News ministry of tourismwildlife https://www.wildhawaii.org/ Home | Hawaii Wildlife Fund Jun 19, 2026 - Join Hawaiʻi Wildlife Fund in their mission to conserve native wildlife through education, research, and community engagement. hawaiiwildlifefund https://bcwf.bc.ca/ B.C. Wildlife Federation | Donate or Become a Member Today Jun 5, 2026 - Working together to protect and conserve B.C.'s fish, wildlife and habitat. Donate or become a member of the B.C. Wildlife Federation. donate or become a memberwildlifefederationtoday https://www.fws.gov/refuge/bear-river-migratory-bird Bear River Migratory Bird Refuge | U.S. Fish & Wildlife Service Bear River Migratory Bird Refuge lies in Northern Utah, where the Bear River flows into the Northeast arm of the Great Salt Lake. On the ancestral homelands of... bear rivermigratory birdu srefugefish https://www.sharadvats.com/ Top Tiger Safari in India - Book Wildlife Safari Tours 2026 Feb 6, 2026 - Book Luxury tiger safari in India with Sharad Vats Safaris. Best selling wildlife safari adventures in premium lodges with expert naturalists in top parks. tiger safari in indiawildlife tourstopbook https://www.aspenvalley.ca/ Keep Wildlife Wild | Aspen Valley Wildlife Sanctuary Aspen Valley's goal is to care for injured and orphaned wildlife and, once rehabilitated, return them to their natural environment keep wildlife wildaspenvalleysanctuary https://stevenlyon.com/ Steven Lyon Studio - photographer, director, wildlife activist Jun 9, 2026 - Artist website for photographer, director, and documentary filmmaker, Steven Lyon. steven lyonstudio photographerdirectorwildlifeactivist https://www.pugdundeesafaris.com/ Wildlife Safari In India | Tiger Safari in India | Tiger Tours wildlife safariin indiatigertours https://www.wildlifeinsights.org/ Home | Wildlife Insights wildlifeinsights https://www.npws.ie/ National Parks & Wildlife Service national parkswildlifeservice https://www.wildlifedepartment.com/ Oklahoma Department of Wildlife Conservation | Oklahoma Department of Wildlife Conservation Homepage for the Oklahoma Department of Wildlife Conservation. Purchase your hunting or fishing license. Explore Outdoor Oklahoma and more. department ofoklahomawildlifeconservation https://www.fws.gov/office/pacific-islands-fish-and-wildlife Pacific Islands Fish and Wildlife Office | U.S. Fish & Wildlife Service Welcome to the Pacific Islands Fish and Wildlife Office! We are part of the U.S. Fish and Wildlife Service's ecological services program. Here we work closely... fish and wildlifepacific islandsoffice uservice https://www.wlf.louisiana.gov/page/seasons-and-regulations Seasons and Regulations | Louisiana Department of Wildlife and Fisheries Louisiana Department of Wildlife and Fisheries recreational and commercial hunting, fishing, and trapping seasons and regulations. department ofseasonsregulationslouisianawildlife https://ugallaprimateproject.com/ Primate Research, Conservation, and Wildlife Studies primateresearchconservationwildlifestudies https://www.alltanzaniasafaris.com/ All Tanzania Safaris | Tanzania Safaris | Tanzania Wildlife Safaris Oct 24, 2025 - All Tanzania Safaris Offers unique Lifetime adventure. Tanzania Safari Tours provides unforgettable experiences through its vast wilderness and the majestic... all tanzania safariswildlife https://watch.eventive.org/wwd2026 Catalog | 2026 World Wildlife Day Showcase world wildlife daycatalogshowcase https://cwf-fcf.org/en/ Canadian Wildlife Federation: Your Connection with Wildlife canadian wildlife federationconnection https://www.mydubaipass.com/products/dubai-safari-park-tickets Dubai Safari Park Tickets | Explore Diverse Species Of Wildlife dubai safari park ticketsexplorediversespecieswildlife https://wwf.org.au/ WWF Australia | Protecting Wildlife and their Habitat | | WWF Australia WWF Australia works tirelessly to protect endangered species and their habitats. Join us in the fight against climate change and the protection of our planet's... protecting wildlifewwfaustraliahabitat https://appletonwildlifediary.wordpress.com/ Appleton Wildlife Diary by Alex White | This is my diary of the wildlife where I live in... This is my diary of the wildlife where I live in Oxfordshire, and sometimes the places I visit. I am a 18 year old young naturalist with a passion for British... https://www.kidepovalleynationalparkuganda.com/ Kidepo Valley National Park (Uganda Wildlife Safari Destination) 2022/23 Feb 24, 2022 - Kidepo Valley National Park Uganda kidepo valley national parkuganda wildlife safaridestination https://sandiegozoowildlifealliance.org/ San Diego Zoo Wildlife Alliance | Home page san diego zooalliance homewildlife https://www.fws.gov/refuge/pelican-island Pelican Island National Wildlife Refuge | U.S. Fish & Wildlife Service America’s first National Wildlife Refuge is located near the Atlantic coastal community of Sebastian, Florida. A little island in the Indian River Lagoon, a... national wildlife refugepelicanislandfishservice https://alerts.dbca.wa.gov.au/ Parks and Wildlife Service - Department of Biodiversity, Conservation and Attractions - Park Alerts... parks and wildlifeservice departmentbiodiversity conservation https://sazoo.org/ San Antonio Zoo - Explore Wildlife and Family Fun Today Jun 11, 2026 - Discover the wonders of wildlife at San Antonio Zoo. Plan your visit and explore exciting exhibits, fun attractions, and incredible animals today! san antonio zooexplore wildlifefamily funtoday https://www.surreywildlifetrust.org/ Protecting nature & wild places in Surrey | Surrey Wildlife Trust Working to protect wildlife and wild places in Surrey with the help of members, volunteers and supporters. protecting naturewild placessurreywildlifetrust https://birdwatchingguide.net/ Luxury Bird Watching Tours | Ecotours Wildlife | Luxury Bird Watching Tours & Private Birding... Experience private, cinematic birding expeditions crafted for discerning travelers seeking rare wildlife encounters in stunning natural settings. bird watching toursluxuryecotourswildlifeprivate https://wildsounds.co.uk/ UK's Top Wildlife Sounds - Home | WildSounds Explore Wild Sounds for a unique selection of wildlife, natural history and environmental books, CDs and DVDs. Connect with nature at home. uktopwildlifesounds https://sandiegozoowildlifealliance.org/support-us Support Us | San Diego Zoo Wildlife Alliance san diego zoosupport uswildlifealliance https://etowahwildlifeexpo.com/ Etowah Wildlife Expo etowahwildlifeexpo https://wildernessbyklaus.com/ Hyper-Realistic Wildlife Displays | Wilderness by Klaus Jan 2, 2026 - Experience lifelike, natural environments handcrafted by Wilderness by Klaus — hyper-realistic habitat recreations that bring the wild indoors. Contact us! hyperrealisticwildlifedisplayswilderness https://taitahillswildlifesanctuary.com/ Taita Hills Wildlife Sanctuary – The heart of Tsavo taita hillswildlife sanctuarythe hearttsavo https://www.wildmadagascar.org/ Madagascar: stunning wildlife, landscapes, and cultural diversity madagascarstunningwildlifelandscapescultural https://wwjournal.org/ Western Wildlife westernwildlife