https://www.ecoteam.lk/
Eco Team Sri Lanka | Sustainable Wildlife and Adventure Tours
Experience Sri Lanka with Eco Team: sustainable wildlife safaris, adventure tours, eco-lodges, and cultural journeys. Pioneering responsible travel since 2000
eco teamsri lankasustainablewildlifeadventure
https://primatesofpanama.org/
Home - Primates of Panama | Wildlife Conservation & Research Projects
wildlife conservationprimatespanamaresearchprojects
https://sabuklodge.com/
Home - Sabuk Lodge | Safari, Nature & Luxury Wildlife Retreat
Sep 28, 2025 - Welcome to Sabuk Lodge, a sanctuary where nature, comfort, and culture meet in harmony. Tucked away from the fast pace of modern life, Sabuk Lodge offers...
lodge safarinature luxurysabukwildliferetreat
https://www.fws.gov/
U.S. Fish and Wildlife Service | U.S. Fish & Wildlife Service
fish and wildlifeuservice
https://pwrillinois.com/
Wildlife Removal Services Plano, IL | PWR Illinois
wildlife removal servicesplanopwrillinois
https://myfwc.com/
Florida Fish and Wildlife Conservation Commission | FWC
Managing fish and wildlife resources for their long-term well-being and the benefit of people.
fish and wildlifeconservation commissionfloridafwc
https://ugandawildlife.org/
Uganda Wildlife Authority - UWA
uganda wildlife authorityuwa
https://www.rspb.org.uk/
RSPB Bird & Wildlife Conservation Charity
wildlife conservationrspbbirdcharity
https://www.wildlifetrusts.org/
Home | The Wildlife Trusts
The Wildlife Trusts is a federation of 47 independent wildlife conservation charities covering the UK, Alderney and the Isle of Man. We manage nature reserves,...
the wildlifetrusts
https://www.kabinivacations.net/
Kabini Tour Packages - Wildlife amidst Scenic Paradise
Kabini Tour Packages offers tours to wildlife destination amid great scenic paradise to give you a blissful experience. Book your holidays at Kabini Vacations
kabini tour packageswildlifeamidstscenicparadise
https://www.bestpestcontrolsheridan.com/
Best Pest Control Sheridan Wyoming | Wildlife Control Services
best pest controlsheridanwyomingwildlifeservices
https://nbwildliferanchtx.com/
nbwildliferanchtx.com - Texas Wildlife Domain
Discover nbwildliferanchtx.com, a premium domain for wildlife ranches in Texas.
texas wildlifedomain
https://www.shamrockpestmanagement.ca/
Shamrock Pest Management Services - Wildlife Removal Services & Exterminator including Mosquito &...
Shamrock Pest Management Services is a family-owned business in the area of Grand Bend Ontario, providing a broad variety of services ranging from residential...
shamrock pest managementwildlife removalservicesexterminatorincluding
https://mountainsandmist.com/
Mountains and Mist Wildlife and Nature Art, Photography and Workshops
Mountains and Mist - Wildlife Art, Nature Art, Nature Photography and Workshops
mountains and mistnature artwildlifephotographyworkshops
https://dnpwc.gov.np/
Department of National Parks and Wildlife Conservation Barbarmahal
Powered by GIWMS | DOIT
national parks and wildlifedepartment ofconservation
https://ugandawildlifetours.com/
Home - Top Budget & Eco-friendly Uganda Wildlife Tours 2025
Apr 10, 2026 - Home: Discover tailored tours, budget and luxury options, and unforgettable experiences in the Pearl of Africa. Plan your Uganda safari today!
uganda wildlife tourshome topeco friendlybudget
https://www.ecowice.org/
Homepage - Environmental Conservation for Wildlife and Community Enterprise
Jul 15, 2026 - Experience a thrilling start with generous welcome bonuses and ongoing promotions at 1win, enhanced by regular cashback offers, making every bet more rewarding...
environmental conservationhomepagewildlifecommunityenterprise
https://tpwd.texas.gov/
Texas Parks & Wildlife Department
TPWD.Texas.gov is the place to find information about Texas state parks, hunting, fishing, licenses, wildlife, Game Wardens, boat registration and more.
texas parkswildlifedepartment
https://www.outdoorguide.com/
Outdoor Guide - For Those Who Live Outside: Safety, Wildlife, Tips, Gardening, & Travel
Outdoor Guide will help you live your best life outside - from wildlife guides, to safety information, gardening tips, and more.
outdoor guidelive outside
https://www.hiwwt.org.uk/
Hampshire & Isle of Wight Wildlife Trust | Hampshire and Isle of Wight Wildlife Trust
isle of wightwildlife trusthampshire
https://bajaex.com/
Whale Watching. Ocean Safaris. Extraordinary Wildlife. | Baja Expeditions
whale watchingoceansafarisextraordinarywildlife
https://www.nwf.org/
National Wildlife Federation
Uniting all Americans to ensure wildlife thrive in a rapidly changing world, the National Wildlife Federation builds upon our nation's conservation heritage...
national wildlifefederation
https://www.sheldrickwildlifetrust.org/
Sheldrick Wildlife Trust: Haven for Elephants & Rhinos
Pioneers in the rescue and hand-raising of orphaned baby elephants and rhinos, through to their reintegration to the wild when grown. Saving wild lives today...
sheldrick wildlife trustelephantsrhinos
https://scottishwildlifetrust.org.uk/
Scottish Wildlife Trust - Scotland's leading nature conservation charity
Jul 13, 2026 - Find out about the latest news, project updates, events and opportunities with the Scottish Wildlife Trust, Scotland's leading nature conservation charity.
scottish wildlife trustnature conservationscotlandleadingcharity
https://manitobahabitattrust.com/
Manitoba Habitat Trust | Conservation & Wildlife Preservation
Manitoba Habitat Trust - Protecting and preserving Manitoba's natural habitats and wildlife through conservation, restoration, and education initiatives.
manitobahabitattrustconservationwildlife
https://wildlife.ca.gov/
California Department of Fish and Wildlife Home Page
The Department of Fish and Wildlife manages California's diverse fish, wildlife, and plant resources, and the habitats upon which they depend, for their...
fish and wildlifedepartment ofcalifornia
https://bronxzoo.com/
Saving Wildlife and Wild Places - Bronx Zoo
General information, zoo history, map, education program summary, animal photos and descriptions, and calendar of events. Part of The Wildlife Conservation...
saving wildlifeplacesbronxzoo
https://fwegb.gov.pk/
Home - Forest, Wildlife & Environment Department Government of Gilgit-Baltistan
Illegal Timber Smuggling foiled at Dambodas Forest Check Post Chief Secretary Gilgit-Baltistan Visited Forest Park Skardu A cleanliness campaign was carried...
forest wildlifeenvironment departmentgovernmentgilgitbaltistan
https://www.plantbiologic.com/
Food Plot Seed for Deer, Turkey, and Wildlife | Plant BioLogic
Plant BioLogic has changed the way gamekeepers manage their herds and properties. Find high quality food plot seed for deer, turkey, and other wildlife here!
food plot seeddeerturkeywildlifeplant
https://uwec.ug/
Uganda Wildlife Conservation Education Centre – entebbe zoo
uganda wildlifeconservation educationcentreentebbezoo
https://www.nativnurseries.com/
Mossy Oak Nativ Nurseries - Oak Trees and Fruit Trees for Wildlife
Mossy Oak Nativ Nurseries is dedicated to growing the country's best seedlings and plants for nature enthusiasts, wildlife and habitat managers. Shop our...
mossy oaknativ nurseriestreesfruitwildlife
https://www.outdoorphotographymagazine.co.uk/
Outdoor Photography Magazine: Landscape | wildlife | nature | adventure
Jul 7, 2026 - Outdoor Photography is the UK’s leading magazine dedicated to landscape, wildlife, nature, travel and adventure. Ideal for photographers of all levels.
outdoor photography magazinelandscapewildlifenatureadventure
https://wdfw.wa.gov/
Home | Washington Department of Fish & Wildlife
The Washington Department of Fish and Wildlife is dedicated to preserving, protecting, and perpetuating the state’s fish, wildlife, and ecosystems
department ofwashingtonfishwildlife
https://animalswildfacts.com/
Animals Wild Facts – Discover Amazing Animal Facts, Lists & Wildlife Guides
May 30, 2026 - Discover amazing animal facts, wildlife guides, and detailed species lists on Animals Wild Facts. Explore habitats, behaviors, and fun facts about animals...
animals wildfactsdiscoveramazinglists
https://www.maine.gov/ifw/
Maine Dept of Inland Fisheries and Wildlife
mainedeptinlandfisherieswildlife
https://hebnaturenotes.org/
Hebridean Nature Notes, Outer Hebrides wildlife & landscapes
Dec 5, 2025 - Hebridean Nature Notes, observations and reflections of local naturalists on the wildlife and landscapes of the islands of the Outer Hebrides.
hebridean nature notesouter hebrideswildlifelandscapes
https://www.tpwf.org/
Texas Parks and Wildlife Foundation - Home
Oct 8, 2025 - Texas Parks and Wildlife Foundation leverages public funds with private philanthropy to create lasting changes in how TPWD stewards our natural resources.
texas parks and wildlifefoundation
https://dwr.virginia.gov/
Virginia Department of Wildlife Resources (DWR)
Virginia DWR is responsible for the management of inland fisheries, wildlife, and recreational boating for the Commonwealth of Virginia.
department ofwildlife resourcesvirginiadwr
https://currumbinsanctuary.com.au/
Gold Coast's #1 Attraction | Currumbin Wildlife Sanctuary
Jul 13, 2026 - Experience Currumbin Wildlife Sanctuary on the Gold Coast! Encounter amazing wildlife, exciting shows, and fun family experiences.
gold coastattractioncurrumbinwildlifesanctuary
https://defenders.org/
Defenders of Wildlife
Defenders of Wildlife works on the ground, in the courts, and on Capitol Hill to protect and restore imperiled wildlife and habitats across North America....
defenderswildlife
https://www.waghobaecolodge.com/
Wildlife Lodges in Tadoba | Luxury Resorts in Tadoba
Waghoba Eco Lodge is a sustainable luxury resort in Tadoba National Park with a luxury pool, lounge and spacious cottages.
wildlifelodgestadobaluxuryresorts
https://www.africanaturalsafaris.com/
Africa Natural Safaris – Safari Company for Wildlife African Safaris for 2026 - 2027
Plan 5000+ African wildlife safaris from $200 for 2026 - 2027 with Africa Natural Safaris, a safari-focused booking Company for Tanzania, Kenya, Uganda, and...
safari companyafricanaturalsafaris
https://denverzoo.org/
Denver Zoo Conservation Alliance | Saving Wildlife Together
Jul 28, 2026 - Your visit supports our wildlife conservation efforts in Colorado + worldwide
denver zooconservation alliancesaving wildlifetogether
https://www.tigersafariindia.co.uk/
Tiger Safari India: Best Tiger Safari & Wildlife Tours 2026
Apr 16, 2026 - Best Tiger Safari India: Experience seamless tiger safaris in India with expert naturalists, premium hotels and in the popular national parks of India.
tiger safari indiawildlife toursbest
https://coastwildlife.org/
Wildlife Center Of The North Coast • WCNC
May 30, 2026 - WCNC is a non-profit, licensed wildlife rehabilitation and conservation education center located in Astoria, OR serving the north Oregon Coast.
the north coastwildlife centerwcnc
https://mogowildlifepark.com.au/
Home - Mogo Wildlife Park
Jul 9, 2026 - Get closer to Australian Animals in their habitats at Featherdale Sydney Wildlife Park. Pat a koala and experience the largest collection of Australian animals...
mogowildlifepark
https://www.cheaprwandasafaris.com/
Cheap Rwanda Safaris: Budget Gorilla Trekking & Wildlife safaris
Oct 28, 2025 - Cheap Rwanda safaris offer budget gorilla trekking and wildlife safaris in Rwanda, budget Rwanda safaris are an option for visiting Rwanda.
budget gorilla trekkingrwanda safarischeapwildlife
https://www.naturesafariindia.com/
Best Tiger Safari in India: Book Wildlife Safari Tours 2026
best tiger safari in indiawildlife toursbook
https://www.africawildlifesafaris.net/
Africa Wildlife Safaris - Africa Vacation Holiday Tours
Feb 5, 2026 - Africa wildlife safaris with Wildhorn Africa. Explore top safari destinations, from the Big Five to gorilla trekking, with tailor-made itineraries,
africa wildlife safarisvacationholidaytours
https://www.wlf.louisiana.gov/page/recreational-fishing-licenses-and-permits
Recreational Fishing Licenses and Permits | Louisiana Department of Wildlife and Fisheries
Louisiana Department of Wildlife and Fisheries recreational fishing license and permit information
licenses and permitsrecreational fishingdepartment oflouisianawildlife
https://nwf.org/
National Wildlife Federation
Uniting all Americans to ensure wildlife thrive in a rapidly changing world, the National Wildlife Federation builds upon our nation's conservation heritage...
national wildlifefederation
https://www.wcs.org/
Saving Wildlife and Wild Places - WCS.org
The Wildlife Conservation Society saves wildlife and wild places worldwide through science, conservation action, education, and inspiring people to value...
saving wildlifeplaceswcs
https://www.wires.org.au/
WIRES - Wildlife Information Rescue and Education Service
Support WIRES in rescuing and rehabilitating Australia's wildlife. Your donation helps provide critical emergency response and resources for native animals in...
wildlife informationwiresrescueeducationservice
https://www.fws.gov/program/sport-fish-restoration
Sport Fish Restoration | U.S. Fish & Wildlife Service
The Sport Fish Restoration Program was created in 1950 to restore and better manage America's declining fish resources.
sport fish restorationuwildlifeservice
https://www.bornfree.org.uk/
We Are Born Free - Since 1984 we have worked tirelessly for the conservation of wildlife and...
https://sdzwildlifeexplorers.org/
Home | San Diego Zoo Wildlife Explorers
san diego zoowildlifeexplorers
https://www.tourism.go.ug/
Tourism Uganda | Ministry of Tourism Wildlife and Antiquities | Kampala
Official Site for the Ministry of Tourism, Wildlife and Antiquities. MTWA
tourismugandaministrywildlifeantiquities
https://www.highlandwildlifepark.org.uk/
Welcome to Highland Wildlife Park | Highland Wildlife Park
Embark on a wild adventure at Highland Wildlife Park. Encounter amazing animals, support conservation, and explore the Scottish Highlands.
welcome tohighlandwildlifepark
https://mossyoakgamekeeper.com/
Mossy Oak Gamekeeper | Join in Conservation of Land, Habitat & Wildlife
Jul 1, 2026 - Mossy Oak Gamekeeper is the ultimate source for wildlife management and conservation. Videos, articles, podcasts and more. Become a member.
mossy oakjoin ingamekeeperconservationland
https://brevardzoo.org/
Brevard Zoo - We Share Our Joy of Nature to Help Wildlife and People Thrive.
Feb 23, 2026 - There's so much to experience at Brevard Zoo. Our lush, open-air habitats are home to over 900+ animals from around the world! Take your Zoo visit to the next...
https://pelorusfoundation.org/
Pelorus Foundation | Protecting Wildlife and Wild Places
Jun 30, 2026 - Pelorus Foundation is an independent charity that empowers individuals and local communities to preserve and protect the world’s wildlife and wild places for...
pelorus foundationprotecting wildlifeplaces
https://www.topafricasafari.com/
Top Africa Safari | Best Wildlife African Safaris in Tanzania, Kenya, Uganda & Rwanda (2026 - 2027)
Compare top African safari packages with Top Africa Safari, operated by Africa Natural Tours. Discover wildlife safaris in Tanzania, Kenya, Uganda, and Rwanda...
top africa safari
https://oh-web.s3licensing.com/
Wildlife Home
Ohio Division of Wildlife homepage
wildlife
https://www.wildlife-picchio.com/
Picchio: Wildlife Research, Conservation and Eco-Tours in Japan
Nov 26, 2024 - Picchio is a wildlife research center and NPO, based in Japan's Nagano region with a presence in Hokkaido's Shiretoko region and Okinawa's Iriomote area....
wildlife researcheco tourspicchioconservationjapan
https://vtfishandwildlife.com/
Home | Vermont Fish & Wildlife Department
vermontfishwildlifedepartment
https://www.hawaiiwildlifediscoverycenter.org/
Hawaiʻi Wildlife Discovery Center on Maui
wildlife discovery centermaui
https://www.tourism.go.ke/
Ministry of Tourism and Wildlife
Our Wildlife Our Places Tour Kenya Our News
ministry of tourismwildlife
https://www.wildhawaii.org/
Home | Hawaii Wildlife Fund
Jun 19, 2026 - Join Hawaiʻi Wildlife Fund in their mission to conserve native wildlife through education, research, and community engagement.
hawaiiwildlifefund
https://bcwf.bc.ca/
B.C. Wildlife Federation | Donate or Become a Member Today
Jun 5, 2026 - Working together to protect and conserve B.C.'s fish, wildlife and habitat. Donate or become a member of the B.C. Wildlife Federation.
donate or become a memberwildlifefederationtoday
https://www.fws.gov/refuge/bear-river-migratory-bird
Bear River Migratory Bird Refuge | U.S. Fish & Wildlife Service
Bear River Migratory Bird Refuge lies in Northern Utah, where the Bear River flows into the Northeast arm of the Great Salt Lake. On the ancestral homelands of...
bear rivermigratory birdu srefugefish
https://www.sharadvats.com/
Top Tiger Safari in India - Book Wildlife Safari Tours 2026
Feb 6, 2026 - Book Luxury tiger safari in India with Sharad Vats Safaris. Best selling wildlife safari adventures in premium lodges with expert naturalists in top parks.
tiger safari in indiawildlife tourstopbook
https://www.aspenvalley.ca/
Keep Wildlife Wild | Aspen Valley Wildlife Sanctuary
Aspen Valley's goal is to care for injured and orphaned wildlife and, once rehabilitated, return them to their natural environment
keep wildlife wildaspenvalleysanctuary
https://stevenlyon.com/
Steven Lyon Studio - photographer, director, wildlife activist
Jun 9, 2026 - Artist website for photographer, director, and documentary filmmaker, Steven Lyon.
steven lyonstudio photographerdirectorwildlifeactivist
https://www.pugdundeesafaris.com/
Wildlife Safari In India | Tiger Safari in India | Tiger Tours
wildlife safariin indiatigertours
https://www.wildlifeinsights.org/
Home | Wildlife Insights
wildlifeinsights
https://www.npws.ie/
National Parks & Wildlife Service
national parkswildlifeservice
https://www.wildlifedepartment.com/
Oklahoma Department of Wildlife Conservation | Oklahoma Department of Wildlife Conservation
Homepage for the Oklahoma Department of Wildlife Conservation. Purchase your hunting or fishing license. Explore Outdoor Oklahoma and more.
department ofoklahomawildlifeconservation
https://www.fws.gov/office/pacific-islands-fish-and-wildlife
Pacific Islands Fish and Wildlife Office | U.S. Fish & Wildlife Service
Welcome to the Pacific Islands Fish and Wildlife Office! We are part of the U.S. Fish and Wildlife Service's ecological services program. Here we work closely...
fish and wildlifepacific islandsoffice uservice
https://www.wlf.louisiana.gov/page/seasons-and-regulations
Seasons and Regulations | Louisiana Department of Wildlife and Fisheries
Louisiana Department of Wildlife and Fisheries recreational and commercial hunting, fishing, and trapping seasons and regulations.
department ofseasonsregulationslouisianawildlife
https://ugallaprimateproject.com/
Primate Research, Conservation, and Wildlife Studies
primateresearchconservationwildlifestudies
https://www.alltanzaniasafaris.com/
All Tanzania Safaris | Tanzania Safaris | Tanzania Wildlife Safaris
Oct 24, 2025 - All Tanzania Safaris Offers unique Lifetime adventure. Tanzania Safari Tours provides unforgettable experiences through its vast wilderness and the majestic...
all tanzania safariswildlife
https://watch.eventive.org/wwd2026
Catalog | 2026 World Wildlife Day Showcase
world wildlife daycatalogshowcase
https://cwf-fcf.org/en/
Canadian Wildlife Federation: Your Connection with Wildlife
canadian wildlife federationconnection
https://www.mydubaipass.com/products/dubai-safari-park-tickets
Dubai Safari Park Tickets | Explore Diverse Species Of Wildlife
dubai safari park ticketsexplorediversespecieswildlife
https://wwf.org.au/
WWF Australia | Protecting Wildlife and their Habitat | | WWF Australia
WWF Australia works tirelessly to protect endangered species and their habitats. Join us in the fight against climate change and the protection of our planet's...
protecting wildlifewwfaustraliahabitat
https://appletonwildlifediary.wordpress.com/
Appleton Wildlife Diary by Alex White | This is my diary of the wildlife where I live in...
This is my diary of the wildlife where I live in Oxfordshire, and sometimes the places I visit. I am a 18 year old young naturalist with a passion for British...
https://www.kidepovalleynationalparkuganda.com/
Kidepo Valley National Park (Uganda Wildlife Safari Destination) 2022/23
Feb 24, 2022 - Kidepo Valley National Park Uganda
kidepo valley national parkuganda wildlife safaridestination
https://sandiegozoowildlifealliance.org/
San Diego Zoo Wildlife Alliance | Home page
san diego zooalliance homewildlife
https://www.fws.gov/refuge/pelican-island
Pelican Island National Wildlife Refuge | U.S. Fish & Wildlife Service
America’s first National Wildlife Refuge is located near the Atlantic coastal community of Sebastian, Florida. A little island in the Indian River Lagoon, a...
national wildlife refugepelicanislandfishservice
https://alerts.dbca.wa.gov.au/
Parks and Wildlife Service - Department of Biodiversity, Conservation and Attractions - Park Alerts...
parks and wildlifeservice departmentbiodiversity conservation
https://sazoo.org/
San Antonio Zoo - Explore Wildlife and Family Fun Today
Jun 11, 2026 - Discover the wonders of wildlife at San Antonio Zoo. Plan your visit and explore exciting exhibits, fun attractions, and incredible animals today!
san antonio zooexplore wildlifefamily funtoday
https://www.surreywildlifetrust.org/
Protecting nature & wild places in Surrey | Surrey Wildlife Trust
Working to protect wildlife and wild places in Surrey with the help of members, volunteers and supporters.
protecting naturewild placessurreywildlifetrust
https://birdwatchingguide.net/
Luxury Bird Watching Tours | Ecotours Wildlife | Luxury Bird Watching Tours & Private Birding...
Experience private, cinematic birding expeditions crafted for discerning travelers seeking rare wildlife encounters in stunning natural settings.
bird watching toursluxuryecotourswildlifeprivate
https://wildsounds.co.uk/
UK's Top Wildlife Sounds - Home | WildSounds
Explore Wild Sounds for a unique selection of wildlife, natural history and environmental books, CDs and DVDs. Connect with nature at home.
uktopwildlifesounds
https://sandiegozoowildlifealliance.org/support-us
Support Us | San Diego Zoo Wildlife Alliance
san diego zoosupport uswildlifealliance
https://etowahwildlifeexpo.com/
Etowah Wildlife Expo
etowahwildlifeexpo
https://wildernessbyklaus.com/
Hyper-Realistic Wildlife Displays | Wilderness by Klaus
Jan 2, 2026 - Experience lifelike, natural environments handcrafted by Wilderness by Klaus — hyper-realistic habitat recreations that bring the wild indoors. Contact us!
hyperrealisticwildlifedisplayswilderness
https://taitahillswildlifesanctuary.com/
Taita Hills Wildlife Sanctuary – The heart of Tsavo
taita hillswildlife sanctuarythe hearttsavo
https://www.wildmadagascar.org/
Madagascar: stunning wildlife, landscapes, and cultural diversity
madagascarstunningwildlifelandscapescultural
https://wwjournal.org/
Western Wildlife
westernwildlife