https://openreview.net/forum?id=CXPb4twsrq
Tabula: Efficiently Computing Nonlinear Activation Functions for Secure Neural Network Inference |...
Multiparty computation approaches to secure neural network inference commonly rely on garbled circuits for securely executing nonlinear activation functions....
activation functionsneural networktabulaefficientlycomputing
https://github.com/joaquimcampos/DeepSplines
GitHub - joaquimcampos/DeepSplines: Learning Activation Functions in Deep (Spline) Neural Networks...
Learning Activation Functions in Deep (Spline) Neural Networks - joaquimcampos/DeepSplines
activation functionsin deepgithublearning
https://arxiv.org/abs/1412.6830v1
[1412.6830v1] Learning Activation Functions to Improve Deep Neural Networks
Abstract page for arXiv paper 1412.6830v1: Learning Activation Functions to Improve Deep Neural Networks
activation functionslearningimprovedeepneural
https://openreview.net/forum?id=U9InOfOQcf
On Output Activation Functions for Adversarial Losses: A Theoretical Analysis via Variational...
Recent years have seen adversarial losses been applied to many fields. Their applications extend beyond the originally proposed generative modeling to...
activation functions
https://openreview.net/forum?id=rke_YiRct7
Small nonlinearities in activation functions create bad local minima in neural networks | OpenReview
We constructively prove that even the slightest nonlinear activation functions introduce spurious local minima, for general datasets and activation functions.
activation functions
https://openreview.net/forum?id=tLtf4lRz0l
A Method on Searching Better Activation Functions | OpenReview
The success of artificial neural networks (ANNs) hinges greatly on the judicious selection of an activation function, introducing non-linearity into network...
a methodactivation functionssearchingbetteropenreview
https://deepai.org/publication/recurrent-neural-networks-with-flexible-gates-using-kernel-activation-functions
Recurrent Neural Networks with Flexible Gates using Kernel Activation Functions | DeepAI
Jul 11, 2018 - 07/11/18 - Gated recurrent neural networks have achieved remarkable results in the analysis of sequential data. Inside these networks, gates ...
recurrent neural networksactivation functionsflexible
https://wandb.ai/shweta/Activation%20Functions/reports/Activation-Functions-Compared-With-Experiments--VmlldzoxMDQwOTQ
Activation Functions Compared With Experiments
activation functionscomparedexperiments
https://deepai.org/publication/compact-approximating-complex-activation-functions-for-secure-computation
Compact: Approximating Complex Activation Functions for Secure Computation | DeepAI
Sep 9, 2023 - 09/09/23 - Secure multi-party computation (MPC) techniques can be used to provide data privacy when users query deep neural network (DNN) mod...
activation functionscompactcomplexsecurecomputation
https://deepai.org/publication/learning-activation-functions-for-sparse-neural-networks
Learning Activation Functions for Sparse Neural Networks | DeepAI
May 18, 2023 - 05/18/23 - Sparse Neural Networks (SNNs) can potentially demonstrate similar performance to their dense counterparts while saving significant...
activation functionsneural networkslearningsparsedeepai
https://www.analyticsvidhya.com/blog/2023/10/activation-functions-in-neural-networks/
Demystifying Activation Functions in Neural Networks - Analytics Vidhya
Oct 17, 2023 - Unlock the Power of Neural Networks with Activation Functions: From Sigmoid to ReLU, Explore Their Roles and Impact on Training.
activation functionsneural networksdemystifyinganalyticsvidhya
https://openreview.net/forum?id=3dpOZ2dZcAa
Learning Activation Functions for Sparse Neural Networks | OpenReview
Optimizing activation functions and hyperparameters for sparse neural networks to improve their performance
activation functionsneural networkslearningsparseopenreview
https://www.analyticsvidhya.com/blog/2020/01/fundamentals-deep-learning-activation-functions-when-to-use-them/
Activation Functions | Fundamentals Of Deep Learning
Apr 3, 2025 - An introduction to activation functions. Article describes when to use which type of activation function and fundamentals of deep learning.
activation functionsfundamentalsdeeplearning
https://www.php.net/manual/ja/function.fann-set-cascade-activation-functions.php
PHP: fann_set_cascade_activation_functions - Manual
Sets the array of cascade candidate activation functions
activation functionsphpsetcascademanual
https://openreview.net/forum?id=ltWade-cpK
Optimal Activation Functions for the Random Features Regression Model | OpenReview
The asymptotic mean squared test error and sensitivity of the Random Features Regression model (RFR) have been recently studied. We build on this work and...
activation functionsfor theregression modeloptimalrandom
https://openreview.net/forum?id=_9k5kTgyHT
Globally Optimal Training of Neural Networks with Threshold Activation Functions | OpenReview
We show that training problem of regularized deep neural networks with threshold activations can be equivalently formulated as a standard convex optimization...
neural networksactivation functionsgloballyoptimaltraining
https://arxiv.org/abs/2411.13010
[2411.13010] Deriving Activation Functions Using Integration
Abstract page for arXiv paper 2411.13010: Deriving Activation Functions Using Integration
activation functionsderivingusingintegration
https://www.preprints.org/manuscript/202508.0478
Fractals in Neural Networks: Introducing a New Class of Activation Functions[v1] | Preprints.org
We introduce a class of activation functions for neural networks based on the Blancmange curve and the Weierstrass function. These activation functions are...
https://www.mpg.de/26251524/the-functions-of-bet-proteins-during-gene-activation
The functions of BET proteins during gene activation | Max-Planck-Gesellschaft
Understanding BRD2's unique function in gene activation may enhance the efficacy of BET inhibitors, leading to precise cancer treatment options.
the functionsmax planckbetproteins
https://jmlr.org/papers/v25/23-0912.html
Deep Network Approximation: Beyond ReLU to Diverse Activation Functions
deepnetworkapproximationbeyondrelu
https://www.easychair.org/publications/preprint/Tlps
Siamese Networks for One Shot Learning using Kernel Based Activation functions
for onesiamesenetworksshot
https://deepai.org/publication/domain-wall-leaky-integrate-and-fire-neurons-with-shape-based-configurable-activation-functions
Domain Wall Leaky Integrate-and-Fire Neurons with Shape-Based Configurable Activation Functions |...
Nov 11, 2020 - 11/11/20 - Complementary metal oxide semiconductor (CMOS) devices display volatile characteristics, and are not well suited for analog applic...
https://deepai.org/publication/optimization-and-generalization-of-shallow-neural-networks-with-quadratic-activation-functions
Optimization and Generalization of Shallow Neural Networks with Quadratic Activation Functions |...
Jun 27, 2020 - 06/27/20 - We study the dynamics of optimization and the generalization properties of one-hidden layer neural networks with quadratic activat...
neural networksoptimizationgeneralizationshallow
https://www.freecodecamp.org/news/activation-functions-in-neural-networks/
How AI Models Think: The Key Role of Activation Functions with Code Examples
Aug 12, 2024 - In Artificial Intelligence, Machine Learning is the foundation of most revolutionary AI applications. From language processing to image recognition, Machine...
https://arxiv.org/html/2602.05688v1
Mining Generalizable Activation Functions
miningactivationfunctions
https://www.ncbi.nlm.nih.gov/Structure/pdb/2XLP
2XLP: Joint-functions of protein residues and NADP(H) in oxygen-activation by flavin-containing...
FLAVIN-CONTAINING MONOOXYGENASE4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACIDDI(HYDROXYETHYL)ETHERFLAVIN-ADENINE DINUCLEOTIDENADP...
https://www.easychair.org/publications/preprint/LCSF
Siamese Networks for One Shot Learning using Kernel Based Activation functions
for onesiamesenetworksshot
https://www.mpg.de/26251524/the-functions-of-bet-proteins-during-gene-activation?c=153839
The functions of BET proteins during gene activation | Max-Planck-Gesellschaft
Understanding BRD2's unique function in gene activation may enhance the efficacy of BET inhibitors, leading to precise cancer treatment options.
the functionsmax planckbetproteins
https://www.omicsonline.org/proceedings/synaptic-adhesion-like-molecule-salm4-regulates-angiogenic-functions-via-vegfr2-activation-80938.html
Synaptic Adhesion Like Molecule (SALM4) Regulates Angiogenic Functions Via VEGFR2 Activation | 80938
Synaptic Adhesion Like Molecules (SALMs) is the adhesion molecules, highly enriched in nervous system, include five members (SALM 1-5). All SALMs promote...
https://elifesciences.org/articles/08898
The RhoGAP activity of CYK-4/MgcRacGAP functions non-canonically by promoting RhoA activation...
Activation of the key regulator of cytokinesis, RhoA, involves an unexpected contribution by a RhoGAP domain.
https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2023.1123155/full
Frontiers | SARS-CoV-2 infection impairs NK cell functions via activation of the LLT1-CD161 axis
Natural killer (NK) cells plays a pivotal role in the control of viral infections, and their function depend on the balance between their activating and inhi...
https://www.easychair.org/publications/preprint/dl1B
Improving Siamese Networks for One-Shot Learning Using Kernel-Based Activation Functions
for one