Robuta

https://www.aafp.org/home.html American Academy of Family Physicians | AAFP The American Academy of Family Physicians represents 124,500 family physicians, residents, and students and provides advocacy, education, and patient and... american academyfamily physiciansaafp https://aasm.org/ American Academy of Sleep Medicine | AASM | Medical Society Jul 24, 2026 - The AASM is advancing sleep care and enhancing sleep health to improve lives through accreditation, membership, standards and education. american academysleep medicineaasmmedicalsociety https://www.aaap.org/ Home - American Academy of Addiction Psychiatry Feb 1, 2022 - AAAP is the premier national professional organization for Addiction Psychiatrists, physicians, and allied health professionals dedicated to education,... american academyaddictionpsychiatry https://sleepeducation.org/ Home Page - Sleep Education - American Academy of Sleep Medicine May 15, 2026 - Sleep Education has reliable information about sleep, sleep disorders, and treatment options with accurate medical and scientific insights. home pagesleep educationamerican academymedicine https://aafs.ac-page.com/communication Connect with the American Academy of Forensic Sciences Manage your communication preferences for the American Academy of Forensic Sciences. Receive relevant communication regarding the industry of forensic science,... the american academyconnect withforensicsciences https://www.americanacademy.de/announcing-the-2021-22-berlin-prize-fellows/ The 2021-22 Berlin Prize Fellows - American Academy in Berlin Oct 4, 2021 - The American Academy has granted fellowships for fall 2021 and spring 2022 to twenty-two outstanding American scholars, writers, composers, and artists. american academyberlinprizefellows https://aap.planmygift.org/donor-advised-funds Donor Advised Funds | the American Academy of Pediatrics A donor advised fund gives you the flexibility to harness the giving power of a private foundation by donating to multiple charitable organizations. donor advised fundsthe american academypediatrics https://www.artsandletters.org/ American Academy of Arts and Letters The American Academy of Arts and Letters is an honor society of the country's 300 leading architects, artists, composers, and writers. academy of artsamericanletters https://www.aafs.org/FEPAC Forensic Science Education Programs Accreditation Commission (FEPAC) | American Academy of Forensic... forensic scienceeducation programsaccreditation commissionamerican academyfepac https://www.entnet.org/ American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS) Jul 30, 2026 - AAO-HNS represents specialists who treat the ears, nose, throat, and related structures of the head and neck. head and neck surgeryamerican academyotolaryngologyaaohns https://www.americanacademy.de/ Home - American Academy in Berlin american academyberlin https://news.emory.edu/stories/2024/07/son_faan_2024/story.html Ten Emory nurses to be inducted into American Academy of Nursing Ten members of the Emory Nursing community will be among the distinguished nurse leaders inducted into the American Academy of Nursing 2024 Class of Fellows.... to beamerican academytenemorynurses https://www.aan.com/ American Academy of Neurology: Neurology Resources | AAN The American Academy of Neurology is dedicated to enhancing member career fulfillment and promoting brain health for all. american academy of neurologyresourcesaan https://aapmentorship.chronus.com/ American Academy of Pediatrics Mentorship Program | Program Overview american academymentorship programpediatricsoverview https://www.aad.org/ American Academy of Dermatology american academydermatology https://www.americanacademy.de/the-2026-27-berlin-prize-fellows/ The 2026-27 Berlin Prize Fellows - American Academy in Berlin Jun 12, 2026 - Berlin, May 11, 2026: The American Academy in Berlin proudly announces the recipients of the 2026-27 Berlin Prize. american academyberlinprizefellows https://www.aacsh.com/ American Academy of Cosmetic Surgery in Dubai | Plastic Surgery & Aesthetic Treatments Jun 12, 2026 - American Academy of Cosmetic Surgery Hospital in Dubai specializes in expert plastic surgery, hair transplants, and aesthetic treatments to help you achieve... american academycosmetic surgeryin dubaiplasticaesthetic https://www.aan.com/PressRoom/home/PressRelease/5322 American Academy of Neurology: Neurology Resources | AAN american academy of neurologyresourcesaan https://www.aaos.org/ American Academy of Orthopaedic Surgeons AAOS The American Academy of Orthopaedic Surgeons (AAOS) provides education programs for orthopaedic surgeons and allied health professionals, champions and... american academyorthopaedic surgeonsaaos https://aaopt.org/ American Academy of Optometry american academyoptometry https://aafs.secure-platform.com/membership American Academy of Forensic Sciences - american academyforensicsciences https://www.aapss.org/2024-fellows-announcement/ American Academy of Political and Social Science Announces 2024 Fellowships – AAPSS political and socialamerican academy https://www.healthychildren.org/English/news/Pages/Updated-Guidance-on-Sport-Related-Concussions.aspx American Academy of Pediatrics Offers Updated Guidance on Sport-Related Concussions -... Guidance on treatment and recovery of injured players has evolved. A new AAP report reflects the latest research on recommendations, which now call for... american academyupdated guidancepediatricsoffers https://www.inaap.org/ Home | Indiana Chapter of the American Academy of Pediatrics INAAP is the go-to resource for pediatric information in the state of Indiana. Our focus is on both the improvement of child health, as well as the practice of... the american academyindiana chapterpediatrics https://aacfp.org/ American Academy of Craniofacial Pain - Home american academycraniofacialpain https://news.virginia.edu/content/2-uva-scientists-elected-american-academy-arts-sciences 2 UVA scientists elected to American Academy of Arts & Sciences Apr 29, 2026 - The UVA researchers were elected for their work advancing understanding of disease and environmental challenges. academy of artsuvascientistselectedamerican https://irjci.blogspot.com/2022/12/historic-native-american-academys-last.html The Rural Blog: Historic Native American academy's last building in danger The Choctaw tribe paid for a protective cover for the building. (Image from WKYT-TV ) When Dr. William 'Chip' Richardson bought some land n... the ruralnative american https://am2025.perio.org/ American Academy of Periodontology - Annual Meeting 2025 Sep 26, 2025 - The 2025 American Academy of Periodontology Annual Meeting will be held Oct. 15 - 18, 2025 in Toronto! Register now to learn, share, and network! american academyannual meetingperiodontology https://energy.wisc.edu/news/two-wei-researchers-elected-american-academy-microbiology Two WEI researchers elected to American Academy of Microbiology | Wisconsin Energy Institute Two Wisconsin Energy Institute researchers have been elected to the American Academy of Microbiology.Chris Todd Hittinger and Jean-Michel Ane were among 65... american academy https://www.encyclopedia.com/education/news-and-education-magazines/american-academy-neurology American Academy of Neurology | Encyclopedia.com American Academy of NeurologyClinical Research Training Fellowships (Other/Fellowship)Medical Student Summer Research Scholarships... american academy of neurologyencyclopedia https://www.amacad.org/publication/case-for-arts-education Art for Life’s Sake | American Academy of Arts and Sciences Mar 10, 2023 - This report from the Commission on the Arts calls on parents, teachers, and governments at the national, state, and local level to recognize the value of arts... academy of artssakeamericansciences https://jobs.aapd.org/ American Academy of Pediatric Dentistry (AAPD), AAPD Career Center|Find Your Career Here American Academy of Pediatric Dentistry (AAPD) - Find your next career at AAPD Career Center. Check back frequently as new jobs are posted every day. american academypediatric dentistrycareer centerfind your https://am2024.perio.org/ American Academy of Periodontology - Annual Meeting 2024 Aug 7, 2024 - The 2024 American Academy of Periodontology Annual Meeting will be held Oct. 31- Nov. 3, 2024 in San Diego, CA! Register now to learn, share, and network! american academyannual meetingperiodontology https://www.pepmed.org/ AAPM - American Academy of Peptide Medicine The official nonprofit academic society for peptide medicine. Advancing policy advocacy, clinician education, and safety standards to protect patient access... american academyaapmpeptidemedicine https://jobboard.kansasaap.org/ Kansas Chapter American Academy of Pediatrics (KAAP), KAAP Career Center|Find Your Career Here Kansas Chapter American Academy of Pediatrics (KAAP) - Find your next career at KAAP Career Center. Check back frequently as new jobs are posted every day. american academy https://www.eas.caltech.edu/news/professor-goddard-named-to-american-academy-of-arts-and-sciences Professor Goddard Named to American Academy of Arts and Sciences - Division of Engineering and... William A. Goddard III, Charles and Mary Ferkel Professor of Chemistry, Materials Science, and Applied Physics, has been elected to 2010 American Academy of... academy of arts https://www.cs.princeton.edu/news/kai-li-elected-american-academy-arts-and-sciences Kai Li elected to the American Academy of Arts and Sciences | CS the american academyarts and scienceskai li https://www.americanacademy.de/museums-architecture-and-social-engagement/ Museums, Architecture, and Social Engagement - American Academy in Berlin Aug 2, 2019 - Daniel Weiss of The Met and Sir David Chipperfield on the role of museums and architecture in the service of the greater social good. and socialamerican academymuseumsarchitectureengagement https://pathology.wustl.edu/burnham-elected-into-the-american-academy-of-microbiology/ Burnham elected into the American Academy of Microbiology | Pathology & Immunology | Washington... Jan 17, 2018 - Fellows are elected annually through a highly selective, peer-review process, based on their records of scientific achievement and original contributions that... the american academyburnhamelected https://www.amacad.org/new-members-2026 2026 New Member List | American Academy of Arts and Sciences The American Academy of Arts and Sciences announces the more than 250 outstanding individuals who have been elected to the Academy in 2026. See the complete... new member listacademy of artsamericansciences https://aafcinjectables.com/ American Academy of Facial Cosmetics Home Page Dr PRO template project american academyfacial cosmetics https://www.wolterskluwer.com/en-gb/solutions/ovid/jaaos---journal-of-the-american-academy-of-orthopaedic-surgeons-8266 Ovid - JAAOS - Journal of the American Academy of Orthopaedic Surgeons | Wolters Kluwer The Journal of the American Academy of Orthopaedic Surgeons (JAAOS) is The Official Journal of the AAOS. the american academyorthopaedic surgeonsovidjournal https://www.amacad.org/publication/daedalus/automation-ai-work Automation, AI & Work | American Academy of Arts and Sciences Apr 15, 2022 - We characterize artificial intelligence as “routine-biased technological change on steroids,” adding intelligence to automation tools that substitute for... academy of artsautomation aiworkamericansciences https://www.aacp.com/ American Academy of Clinical Psychiatrists american academyclinicalpsychiatrists https://www.prnewswire.com/news/american-academy-of-matrimonial-lawyers/ American Academy of Matrimonial Lawyers News and Press Releases | PR Newswire news and press releasesamerican academymatrimoniallawyers https://today.usc.edu/2-usc-faculty-members-elected-to-the-american-academy-of-arts-sciences/ Two from USC elected to American Academy of Arts & Sciences May 1, 2025 - University of Southern California News academy of artstwouscelectedamerican https://suzanne-s-school-bb41.thinkific.com/collections American Academy of Sound Therapy american academysoundtherapy https://research.vu.nl/en/activities/american-academy-of-religion-annual-meeting-2022/ American Academy of Religion, Annual Meeting 2022 - Vrije Universiteit Amsterdam american academy of religionannual meetingvrije universiteitamsterdam https://pure.psu.edu/en/publications/self-assessment-examination-of-the-american-academy-of-dermatolog-8/ Self-assessment examination of the American Academy of Dermatology - Penn State the american academyself assessmentexaminationdermatologypenn https://news.northeastern.edu/2024/04/24/american-academy-arts-sciences-cohort/?fbclid=IwZXh0bgNhZW0CMTEAAR1B8Isx8HJcKhN1q_VHoy4y_qtgoBvokSGkindEu4LEhdtiELUvb4wRnZ0_aem_AWIDPEEOploQHwxWoTjNYAKOeUzSwUC9XCC5dDoNHDO0IlUNN-n1w5WLJsF6KC6n0dRiPWiQIDdS74bE0OcuKK8V Two Professors Join American Academy of Arts & Sciences Apr 25, 2024 - Professors Elizabeth Mynatt and Eduardo Sontag have been elected to the prestigious American Academy of Arts and Sciences. academy of artstwoprofessorsjoinamerican https://lobbying.wi.gov/Who/PrincipalInformation/2021REG/Information/9386 Wisconsin Chapter of the American Academy of Pediatrics (WIAAP) - Lobbying in Wisconsin Lobbying in Wisconsin the american academywisconsin chapterpediatricslobbying https://aach.thinkific.com/collections/health-professionals?page=2 All Products - American Academy of Clinical Homeopathy all productsamerican academyclinicalhomeopathy https://magazine.northeast.aaa.com/tag/american-academy-of-pediatrics/ American Academy of Pediatrics Archives - Your AAA Network american academypediatricsarchivesaaanetwork https://www.healthychildren.org/Spanish/paginas/about-aap.aspx Acerca de la American Academy of Pediatrics - HealthyChildren.org acerca deamerican academylapediatrics https://pmc.ncbi.nlm.nih.gov/articles/PMC8636351/ Treatment of central disorders of hypersomnolence: an American Academy of Sleep Medicine clinical... This guideline establishes clinical practice recommendations for the treatment of central disorders of hypersomnolence in adults and children. The American... american academysleep medicinetreatmentcentraldisorders https://www.yasamericanacademy.ae/ Yas American Academy | Outstanding American School in Abu Dhabi Jun 24, 2026 - Yas American Academy is an outstanding American school in Yas Island, Abu Dhabi, following the highly regarded US curriculum. yas american academyoutstandingschoolabudhabi https://divinity.ed.ac.uk/news-events/latest-news/archive/2019/american-academy-welcomes-mona-siddiqui American Academy welcomes Mona Siddiqui | School of Divinity | School of Divinity Professor Mona Siddiqui has been elected to the American Academy of Arts and Science. american academyschool ofwelcomesmonasiddiqui https://connect.aafp.org/termsandconditions Terms and Conditions - American Academy of Family Physicians Read the code of conduct for posting to the lists terms and conditionsamerican academyfamilyphysicians https://www.aapalaska.com/ Alaska Chapter of the American Academy of Pediatrics We are the Alaska Chapter of the American Academy of Pediatrics. Our mission is to ensure the health and well-being of the children of Alaska through the... the american academyalaskachapterpediatrics https://www.aarwr.com/ American Academy of Religion, Western Region - About AARWR 2027 Conference Theme Beyond Boundaries and Silos: Toward Interconnection and Collaboration Gregory S. Cootsona, Ph.D., President-Elect and Program Chair american academy of religionwestern region https://www.umass.edu/news/article/alice-harris-elected-american-academy-arts-sciences Alice Harris Elected to American Academy of Arts & Sciences : UMass Amherst Harris, professor emerita of linguistics, is one of 252 leaders in academia, the arts, industry, journalism, philanthropy, policy, research and science to be... academy of artsaliceharriselectedamerican https://www.americanacademy.de/katholisches-schulzentrum-edith-stein/ Katholisches Schulzentrum Edith Stein - American Academy in Berlin May 2, 2018 - On the afternoon of Friday, April 13, 2018, American Academy president Michael P. Steinberg visited the Katholisches Schulzentrum Edith Stein, a Catholic school edith steinamerican academykatholischesschulzentrumberlin https://neuroscience.berkeley.edu/news/yang-dan-elected-american-academy-arts-and-sciences Yang Dan elected to American Academy of Arts and Sciences | Berkeley Neuroscience academy of arts https://maaom.memberclicks.net/ The American Academy of Oral Medicine the american academyoralmedicine https://aarome.org/ Home | American Academy in Rome american academyrome https://fieldreport.caes.uga.edu/news/diez-gonzalez-elected-to-the-american-academy-of-microbiology/ Diez-Gonzalez elected to the American Academy of Microbiology | CAES Field Report Aug 13, 2025 - Francisco Diez-Gonzalez, director of the University of Georgia Center for Food Safety, is one of 65 new fellows admitted into the prestigious American Academy... the american academy https://asm.org/press-releases/2025/february/65-fellows-elected-into-the-american-academy-of-mi 65 Fellows Elected Into the American Academy of Microbiology | ASM.org The Academy elected 65 new fellows to the Class of 2025. the american academyfellowselected https://research.unl.edu/blog/american-academy-of-arts-and-sciences-taps-unl/ UNL | American Academy of Arts and Sciences taps UNL | Office of Research and Innovation The University of Nebraska-Lincoln has accepted an invitation from the American Academy of Arts and Sciences to become a University Affiliate of the Academy.... academy of artsunlamerican https://www.aac.ac.ma/ Home - American Academy Casablanca Home - American Academy Casablanca american academycasablanca https://magazine.wharton.upenn.edu/tag/american-academy-of-orthopedics/ American Academy of Orthopedics Archives - Wharton Magazine american academyorthopedicsarchiveswhartonmagazine https://aa-rm.org/ American Academy of Regenerative Medicine The American Academy of Regenerative Medicine sets the standards and promotes excellence in the field of Regenerative Medicine, related education, research and... american academyregenerativemedicine https://naapd.org/ North American Academy of Piping and Drumming North American Academy of Piping and Drumming - Providing the finest quality piping and drumming instruction available from Beautiful Valle Crucis, North... north americanacademypipingdrumming https://www.encyclopedia.com/science/encyclopedias-almanacs-transcripts-and-maps/american-academy-forensic-sciences American Academy of Forensic Sciences | Encyclopedia.com American Academy of Forensic Sciences The American Academy of Forensic Sciences (AAFS) is a non-profit, professional organization founded in 1948 in an effort... american academyforensic sciencesencyclopedia https://www.sc.edu/study/colleges_schools/nursing/news/2018/faan-2018.php UofSC Nursing alumni inducted as American Academy of Nursing Fellows - College of Nursing |... Dr. Stephanie Burgess, Dr. Gwendolyn Childs and Jeannie Kelley Tomlinson were recognized during the AAN conference on November 3, 2018. academy of fellowsnursing alumniuofscinductedamerican https://www.flipsnack.com/aaapnewsletter/aaap_newsletter_fall_2022.html AAAP_Newsletter_Fall_2022 by American Academy of Addiction Psy... - Flipsnack Fall 2022 AAAP Newsletter american academyaaapnewsletterfall https://www.aafs.org/research/annual-conference-proceedings Annual Conference Proceedings | American Academy of Forensic Sciences Mar 2, 2026 - The Proceedings of the American Academy of Forensic Sciences is an official publication of the American Academy of Forensic Sciences (AAFS). It is devoted to... annual conference proceedingsamerican academyforensicsciences https://hearcareers.audiology.org/ American Academy of Audiology (AAA), HEARCareers|Find Your Career Here American Academy of Audiology (AAA) - Find your next career at HEARCareers. Check back frequently as new jobs are posted every day. american academy of audiologyfind your careeraaa https://careercenter.njaap.org/ Pediatrics Jobs - The New Jersey Chapter, American Academy of Pediatrics The New Jersey Chapter, American Academy of Pediatrics offers the top jobs available in Pediatrics. Search and apply to open positions or post jobs on The New... new jersey chapterpediatrics jobsamerican academy https://www.aale.org/ American Academy for Liberal Education American Academy for Liberal Education - Advancing Excellence in Liberal Education american academyliberaleducation https://psychology.yale.edu/news/jennifer-richeson-elected-american-academy-arts-sciences?page=3 Jennifer Richeson elected to the American Academy of Arts & Sciences | Department of Psychology the american academy https://gaaap.org/ Home - Georgia Chapter American Academy of Pediatrics Apr 24, 2026 - What does Georgia AAP offer? Explore advocacy, leadership, CME opportunities, and resources for pediatric care excellence. georgia chapteramerican academypediatrics https://home.dartmouth.edu/news/2025/11/american-academy-sciences-and-letters-inducts-three?tags=636&page=13 American Academy of Sciences and Letters Inducts Three | Dartmouth academy of sciencesamericanlettersthreedartmouth https://research.msu.edu/news/goldstein-poindexter-and-sullivan-receive-american-academy-nursing-honors Goldstein, Poindexter, and Sullivan Receive American Academy of Nursing Honors | Office of Research... american academy of nursing https://netlab.cs.washington.edu/uncategorized/american-academy-of-arts-sciences American Academy of Arts & Sciences : Mobile Intelligence Lab academy of artsmobile intelligenceamericanscienceslab https://www.wolterskluwer.com/en/solutions/ovid/jaaos--journal-of-the-american-academy-of-orthopaedic-surgeons-8266 Ovid - JAAOS - Journal of the American Academy of Orthopaedic Surgeons | Wolters Kluwer The Journal of the American Academy of Orthopaedic Surgeons (JAAOS) is The Official Journal of the AAOS. the american academyorthopaedic surgeonsovidjournal https://connect.aafprs.org/home Home - American Academy of Facial Plastic and Reconstructive Surgery plastic and reconstructiveamerican academyfacialsurgery https://med.ucf.edu/student-affairs/student-services/student-organizations-student-events/american-academy-of-developmental-medicine-dentistry-aadmd/ American Academy of Developmental Medicine & Dentistry (AADMD) - College of Medicine american academydevelopmentalmedicinedentistrycollege https://www.perio.org/ American Academy of Periodontology American Academy of Periodontology Apr 30, 2026 - The American Academy of Periodontology (AAP) is a 7,500-member professional organization for periodontists. Learn more about gum health. american academyperiodontology https://discovery.fiu.edu/display/venue-0890-8567 Journal of the American Academy of Child and Adolescent Psychiatry the american academychild and adolescentjournalpsychiatry https://www.americanacademy.de/the-2020-21-class-of-berlin-prize-fellows/ The 2020-21 Berlin Prize Fellows - American Academy in Berlin Sep 17, 2020 - Berlin Prize fellowships have been awarded to 21 US-based scholars, writers, and artists. american academyberlinprizefellows https://religion.arizona.edu/news/religious-studies-faculty-american-academy-religion-annual-meeting Religious Studies Faculty at the American Academy of Religion Annual Meeting | Religious Studies Three Religious Studies faculty members will be presenting at the 2014 American Academy of Religion Annual Meeting. Dr. Andrea McComb Sanchez will be... american academy of religionreligious studiesat thefaculty https://aachronym.blogspot.com/2007/12/american-academy-farewell-dinner.html AACHRONYM: American Academy Farewell Dinner The American Academy in Berlin hosted a farewell reception and dinner for the Fall 2007 Fellows, which formally marked the end of the Fall Q... american academyfarewelldinner https://www.aad.org/public?ref=missboux.com American Academy of Dermatology | Public Education Get expert insights into the care and treatment of your skin, hair, and nails for a lifetime of healthy habits. american academydermatologypubliceducation https://jonfleetwood.substack.com/p/american-academy-of-pediatrics-calls American Academy of Pediatrics Calls for Eliminating Religious and Personal Belief Vaccine... AAP has received over $345 million in taxpayer-funded grants and cooperative agreements from U.S. health agencies, including the CDC, HRSA, SAMHSA, NIH, and... american academy https://actu.epfl.ch/news/american-academy-of-arts-and-sciences-elects-gis-4/ American Academy of Arts and Sciences elects Gisou van der Goot - EPFL academy of arts https://asm.org/academy/american-academy-of-microbiology-leadership-nomina American Academy of Microbiology Leadership Call for Volunteers | ASM.org Call for volunteers for open American Academy of Microbiology leadership positions. call for volunteersamerican academymicrobiologyleadershipasm https://aasm.org/about/affiliated-sites/ Affiliated Sites - American Academy of Sleep Medicine Feb 9, 2026 - Here is a list of the AASM's affiliated sites. affiliated sitesamerican academysleepmedicine https://aaplcp.org/ American Academy of Physician Life Care Planners - Home life care plannersamerican academyphysician https://www.aafs.org/membership/manage-status Manage Your Membership Status | American Academy of Forensic Sciences Oct 2, 2025 - Current AAFS members can use the links below to manage, upgrade, promote, or confirm their membership status. Members with retired or disabled status should... manage your membershipamerican academystatusforensicsciences https://digitalcollections.udel.edu/Documents/Detail/american-academy-of-arts-amp-sciences./71084 American Academy of Arts & Sciences. - University of Delaware Digital Collections academy of artsamericansciencesuniversitydelaware