https://www.aafp.org/home.html
American Academy of Family Physicians | AAFP
The American Academy of Family Physicians represents 124,500 family physicians, residents, and students and provides advocacy, education, and patient and...
american academyfamily physiciansaafp
https://aasm.org/
American Academy of Sleep Medicine | AASM | Medical Society
Jul 24, 2026 - The AASM is advancing sleep care and enhancing sleep health to improve lives through accreditation, membership, standards and education.
american academysleep medicineaasmmedicalsociety
https://www.aaap.org/
Home - American Academy of Addiction Psychiatry
Feb 1, 2022 - AAAP is the premier national professional organization for Addiction Psychiatrists, physicians, and allied health professionals dedicated to education,...
american academyaddictionpsychiatry
https://sleepeducation.org/
Home Page - Sleep Education - American Academy of Sleep Medicine
May 15, 2026 - Sleep Education has reliable information about sleep, sleep disorders, and treatment options with accurate medical and scientific insights.
home pagesleep educationamerican academymedicine
https://aafs.ac-page.com/communication
Connect with the American Academy of Forensic Sciences
Manage your communication preferences for the American Academy of Forensic Sciences. Receive relevant communication regarding the industry of forensic science,...
the american academyconnect withforensicsciences
https://www.americanacademy.de/announcing-the-2021-22-berlin-prize-fellows/
The 2021-22 Berlin Prize Fellows - American Academy in Berlin
Oct 4, 2021 - The American Academy has granted fellowships for fall 2021 and spring 2022 to twenty-two outstanding American scholars, writers, composers, and artists.
american academyberlinprizefellows
https://aap.planmygift.org/donor-advised-funds
Donor Advised Funds | the American Academy of Pediatrics
A donor advised fund gives you the flexibility to harness the giving power of a private foundation by donating to multiple charitable organizations.
donor advised fundsthe american academypediatrics
https://www.artsandletters.org/
American Academy of Arts and Letters
The American Academy of Arts and Letters is an honor society of the country's 300 leading architects, artists, composers, and writers.
academy of artsamericanletters
https://www.aafs.org/FEPAC
Forensic Science Education Programs Accreditation Commission (FEPAC) | American Academy of Forensic...
forensic scienceeducation programsaccreditation commissionamerican academyfepac
https://www.entnet.org/
American Academy of Otolaryngology-Head and Neck Surgery (AAO-HNS)
Jul 30, 2026 - AAO-HNS represents specialists who treat the ears, nose, throat, and related structures of the head and neck.
head and neck surgeryamerican academyotolaryngologyaaohns
https://www.americanacademy.de/
Home - American Academy in Berlin
american academyberlin
https://news.emory.edu/stories/2024/07/son_faan_2024/story.html
Ten Emory nurses to be inducted into American Academy of Nursing
Ten members of the Emory Nursing community will be among the distinguished nurse leaders inducted into the American Academy of Nursing 2024 Class of Fellows....
to beamerican academytenemorynurses
https://www.aan.com/
American Academy of Neurology: Neurology Resources | AAN
The American Academy of Neurology is dedicated to enhancing member career fulfillment and promoting brain health for all.
american academy of neurologyresourcesaan
https://aapmentorship.chronus.com/
American Academy of Pediatrics Mentorship Program | Program Overview
american academymentorship programpediatricsoverview
https://www.aad.org/
American Academy of Dermatology
american academydermatology
https://www.americanacademy.de/the-2026-27-berlin-prize-fellows/
The 2026-27 Berlin Prize Fellows - American Academy in Berlin
Jun 12, 2026 - Berlin, May 11, 2026: The American Academy in Berlin proudly announces the recipients of the 2026-27 Berlin Prize.
american academyberlinprizefellows
https://www.aacsh.com/
American Academy of Cosmetic Surgery in Dubai | Plastic Surgery & Aesthetic Treatments
Jun 12, 2026 - American Academy of Cosmetic Surgery Hospital in Dubai specializes in expert plastic surgery, hair transplants, and aesthetic treatments to help you achieve...
american academycosmetic surgeryin dubaiplasticaesthetic
https://www.aan.com/PressRoom/home/PressRelease/5322
American Academy of Neurology: Neurology Resources | AAN
american academy of neurologyresourcesaan
https://www.aaos.org/
American Academy of Orthopaedic Surgeons AAOS
The American Academy of Orthopaedic Surgeons (AAOS) provides education programs for orthopaedic surgeons and allied health professionals, champions and...
american academyorthopaedic surgeonsaaos
https://aaopt.org/
American Academy of Optometry
american academyoptometry
https://aafs.secure-platform.com/membership
American Academy of Forensic Sciences -
american academyforensicsciences
https://www.aapss.org/2024-fellows-announcement/
American Academy of Political and Social Science Announces 2024 Fellowships – AAPSS
political and socialamerican academy
https://www.healthychildren.org/English/news/Pages/Updated-Guidance-on-Sport-Related-Concussions.aspx
American Academy of Pediatrics Offers Updated Guidance on Sport-Related Concussions -...
Guidance on treatment and recovery of injured players has evolved. A new AAP report reflects the latest research on recommendations, which now call for...
american academyupdated guidancepediatricsoffers
https://www.inaap.org/
Home | Indiana Chapter of the American Academy of Pediatrics
INAAP is the go-to resource for pediatric information in the state of Indiana. Our focus is on both the improvement of child health, as well as the practice of...
the american academyindiana chapterpediatrics
https://aacfp.org/
American Academy of Craniofacial Pain - Home
american academycraniofacialpain
https://news.virginia.edu/content/2-uva-scientists-elected-american-academy-arts-sciences
2 UVA scientists elected to American Academy of Arts & Sciences
Apr 29, 2026 - The UVA researchers were elected for their work advancing understanding of disease and environmental challenges.
academy of artsuvascientistselectedamerican
https://irjci.blogspot.com/2022/12/historic-native-american-academys-last.html
The Rural Blog: Historic Native American academy's last building in danger
The Choctaw tribe paid for a protective cover for the building. (Image from WKYT-TV ) When Dr. William 'Chip' Richardson bought some land n...
the ruralnative american
https://am2025.perio.org/
American Academy of Periodontology - Annual Meeting 2025
Sep 26, 2025 - The 2025 American Academy of Periodontology Annual Meeting will be held Oct. 15 - 18, 2025 in Toronto! Register now to learn, share, and network!
american academyannual meetingperiodontology
https://energy.wisc.edu/news/two-wei-researchers-elected-american-academy-microbiology
Two WEI researchers elected to American Academy of Microbiology | Wisconsin Energy Institute
Two Wisconsin Energy Institute researchers have been elected to the American Academy of Microbiology.Chris Todd Hittinger and Jean-Michel Ane were among 65...
american academy
https://www.encyclopedia.com/education/news-and-education-magazines/american-academy-neurology
American Academy of Neurology | Encyclopedia.com
American Academy of NeurologyClinical Research Training Fellowships (Other/Fellowship)Medical Student Summer Research Scholarships...
american academy of neurologyencyclopedia
https://www.amacad.org/publication/case-for-arts-education
Art for Life’s Sake | American Academy of Arts and Sciences
Mar 10, 2023 - This report from the Commission on the Arts calls on parents, teachers, and governments at the national, state, and local level to recognize the value of arts...
academy of artssakeamericansciences
https://jobs.aapd.org/
American Academy of Pediatric Dentistry (AAPD), AAPD Career Center|Find Your Career Here
American Academy of Pediatric Dentistry (AAPD) - Find your next career at AAPD Career Center. Check back frequently as new jobs are posted every day.
american academypediatric dentistrycareer centerfind your
https://am2024.perio.org/
American Academy of Periodontology - Annual Meeting 2024
Aug 7, 2024 - The 2024 American Academy of Periodontology Annual Meeting will be held Oct. 31- Nov. 3, 2024 in San Diego, CA! Register now to learn, share, and network!
american academyannual meetingperiodontology
https://www.pepmed.org/
AAPM - American Academy of Peptide Medicine
The official nonprofit academic society for peptide medicine. Advancing policy advocacy, clinician education, and safety standards to protect patient access...
american academyaapmpeptidemedicine
https://jobboard.kansasaap.org/
Kansas Chapter American Academy of Pediatrics (KAAP), KAAP Career Center|Find Your Career Here
Kansas Chapter American Academy of Pediatrics (KAAP) - Find your next career at KAAP Career Center. Check back frequently as new jobs are posted every day.
american academy
https://www.eas.caltech.edu/news/professor-goddard-named-to-american-academy-of-arts-and-sciences
Professor Goddard Named to American Academy of Arts and Sciences - Division of Engineering and...
William A. Goddard III, Charles and Mary Ferkel Professor of Chemistry, Materials Science, and Applied Physics, has been elected to 2010 American Academy of...
academy of arts
https://www.cs.princeton.edu/news/kai-li-elected-american-academy-arts-and-sciences
Kai Li elected to the American Academy of Arts and Sciences | CS
the american academyarts and scienceskai li
https://www.americanacademy.de/museums-architecture-and-social-engagement/
Museums, Architecture, and Social Engagement - American Academy in Berlin
Aug 2, 2019 - Daniel Weiss of The Met and Sir David Chipperfield on the role of museums and architecture in the service of the greater social good.
and socialamerican academymuseumsarchitectureengagement
https://pathology.wustl.edu/burnham-elected-into-the-american-academy-of-microbiology/
Burnham elected into the American Academy of Microbiology | Pathology & Immunology | Washington...
Jan 17, 2018 - Fellows are elected annually through a highly selective, peer-review process, based on their records of scientific achievement and original contributions that...
the american academyburnhamelected
https://www.amacad.org/new-members-2026
2026 New Member List | American Academy of Arts and Sciences
The American Academy of Arts and Sciences announces the more than 250 outstanding individuals who have been elected to the Academy in 2026. See the complete...
new member listacademy of artsamericansciences
https://aafcinjectables.com/
American Academy of Facial Cosmetics Home Page
Dr PRO template project
american academyfacial cosmetics
https://www.wolterskluwer.com/en-gb/solutions/ovid/jaaos---journal-of-the-american-academy-of-orthopaedic-surgeons-8266
Ovid - JAAOS - Journal of the American Academy of Orthopaedic Surgeons | Wolters Kluwer
The Journal of the American Academy of Orthopaedic Surgeons (JAAOS) is The Official Journal of the AAOS.
the american academyorthopaedic surgeonsovidjournal
https://www.amacad.org/publication/daedalus/automation-ai-work
Automation, AI & Work | American Academy of Arts and Sciences
Apr 15, 2022 - We characterize artificial intelligence as “routine-biased technological change on steroids,” adding intelligence to automation tools that substitute for...
academy of artsautomation aiworkamericansciences
https://www.aacp.com/
American Academy of Clinical Psychiatrists
american academyclinicalpsychiatrists
https://www.prnewswire.com/news/american-academy-of-matrimonial-lawyers/
American Academy of Matrimonial Lawyers News and Press Releases | PR Newswire
news and press releasesamerican academymatrimoniallawyers
https://today.usc.edu/2-usc-faculty-members-elected-to-the-american-academy-of-arts-sciences/
Two from USC elected to American Academy of Arts & Sciences
May 1, 2025 - University of Southern California News
academy of artstwouscelectedamerican
https://suzanne-s-school-bb41.thinkific.com/collections
American Academy of Sound Therapy
american academysoundtherapy
https://research.vu.nl/en/activities/american-academy-of-religion-annual-meeting-2022/
American Academy of Religion, Annual Meeting 2022 - Vrije Universiteit Amsterdam
american academy of religionannual meetingvrije universiteitamsterdam
https://pure.psu.edu/en/publications/self-assessment-examination-of-the-american-academy-of-dermatolog-8/
Self-assessment examination of the American Academy of Dermatology - Penn State
the american academyself assessmentexaminationdermatologypenn
https://news.northeastern.edu/2024/04/24/american-academy-arts-sciences-cohort/?fbclid=IwZXh0bgNhZW0CMTEAAR1B8Isx8HJcKhN1q_VHoy4y_qtgoBvokSGkindEu4LEhdtiELUvb4wRnZ0_aem_AWIDPEEOploQHwxWoTjNYAKOeUzSwUC9XCC5dDoNHDO0IlUNN-n1w5WLJsF6KC6n0dRiPWiQIDdS74bE0OcuKK8V
Two Professors Join American Academy of Arts & Sciences
Apr 25, 2024 - Professors Elizabeth Mynatt and Eduardo Sontag have been elected to the prestigious American Academy of Arts and Sciences.
academy of artstwoprofessorsjoinamerican
https://lobbying.wi.gov/Who/PrincipalInformation/2021REG/Information/9386
Wisconsin Chapter of the American Academy of Pediatrics (WIAAP) - Lobbying in Wisconsin
Lobbying in Wisconsin
the american academywisconsin chapterpediatricslobbying
https://aach.thinkific.com/collections/health-professionals?page=2
All Products - American Academy of Clinical Homeopathy
all productsamerican academyclinicalhomeopathy
https://magazine.northeast.aaa.com/tag/american-academy-of-pediatrics/
American Academy of Pediatrics Archives - Your AAA Network
american academypediatricsarchivesaaanetwork
https://www.healthychildren.org/Spanish/paginas/about-aap.aspx
Acerca de la American Academy of Pediatrics - HealthyChildren.org
acerca deamerican academylapediatrics
https://pmc.ncbi.nlm.nih.gov/articles/PMC8636351/
Treatment of central disorders of hypersomnolence: an American Academy of Sleep Medicine clinical...
This guideline establishes clinical practice recommendations for the treatment of central disorders of hypersomnolence in adults and children. The American...
american academysleep medicinetreatmentcentraldisorders
https://www.yasamericanacademy.ae/
Yas American Academy | Outstanding American School in Abu Dhabi
Jun 24, 2026 - Yas American Academy is an outstanding American school in Yas Island, Abu Dhabi, following the highly regarded US curriculum.
yas american academyoutstandingschoolabudhabi
https://divinity.ed.ac.uk/news-events/latest-news/archive/2019/american-academy-welcomes-mona-siddiqui
American Academy welcomes Mona Siddiqui | School of Divinity | School of Divinity
Professor Mona Siddiqui has been elected to the American Academy of Arts and Science.
american academyschool ofwelcomesmonasiddiqui
https://connect.aafp.org/termsandconditions
Terms and Conditions - American Academy of Family Physicians
Read the code of conduct for posting to the lists
terms and conditionsamerican academyfamilyphysicians
https://www.aapalaska.com/
Alaska Chapter of the American Academy of Pediatrics
We are the Alaska Chapter of the American Academy of Pediatrics. Our mission is to ensure the health and well-being of the children of Alaska through the...
the american academyalaskachapterpediatrics
https://www.aarwr.com/
American Academy of Religion, Western Region - About AARWR
2027 Conference Theme Beyond Boundaries and Silos: Toward Interconnection and Collaboration Gregory S. Cootsona, Ph.D., President-Elect and Program Chair
american academy of religionwestern region
https://www.umass.edu/news/article/alice-harris-elected-american-academy-arts-sciences
Alice Harris Elected to American Academy of Arts & Sciences : UMass Amherst
Harris, professor emerita of linguistics, is one of 252 leaders in academia, the arts, industry, journalism, philanthropy, policy, research and science to be...
academy of artsaliceharriselectedamerican
https://www.americanacademy.de/katholisches-schulzentrum-edith-stein/
Katholisches Schulzentrum Edith Stein - American Academy in Berlin
May 2, 2018 - On the afternoon of Friday, April 13, 2018, American Academy president Michael P. Steinberg visited the Katholisches Schulzentrum Edith Stein, a Catholic school
edith steinamerican academykatholischesschulzentrumberlin
https://neuroscience.berkeley.edu/news/yang-dan-elected-american-academy-arts-and-sciences
Yang Dan elected to American Academy of Arts and Sciences | Berkeley Neuroscience
academy of arts
https://maaom.memberclicks.net/
The American Academy of Oral Medicine
the american academyoralmedicine
https://aarome.org/
Home | American Academy in Rome
american academyrome
https://fieldreport.caes.uga.edu/news/diez-gonzalez-elected-to-the-american-academy-of-microbiology/
Diez-Gonzalez elected to the American Academy of Microbiology | CAES Field Report
Aug 13, 2025 - Francisco Diez-Gonzalez, director of the University of Georgia Center for Food Safety, is one of 65 new fellows admitted into the prestigious American Academy...
the american academy
https://asm.org/press-releases/2025/february/65-fellows-elected-into-the-american-academy-of-mi
65 Fellows Elected Into the American Academy of Microbiology | ASM.org
The Academy elected 65 new fellows to the Class of 2025.
the american academyfellowselected
https://research.unl.edu/blog/american-academy-of-arts-and-sciences-taps-unl/
UNL | American Academy of Arts and Sciences taps UNL | Office of Research and Innovation
The University of Nebraska-Lincoln has accepted an invitation from the American Academy of Arts and Sciences to become a University Affiliate of the Academy....
academy of artsunlamerican
https://www.aac.ac.ma/
Home - American Academy Casablanca
Home - American Academy Casablanca
american academycasablanca
https://magazine.wharton.upenn.edu/tag/american-academy-of-orthopedics/
American Academy of Orthopedics Archives - Wharton Magazine
american academyorthopedicsarchiveswhartonmagazine
https://aa-rm.org/
American Academy of Regenerative Medicine
The American Academy of Regenerative Medicine sets the standards and promotes excellence in the field of Regenerative Medicine, related education, research and...
american academyregenerativemedicine
https://naapd.org/
North American Academy of Piping and Drumming
North American Academy of Piping and Drumming - Providing the finest quality piping and drumming instruction available from Beautiful Valle Crucis, North...
north americanacademypipingdrumming
https://www.encyclopedia.com/science/encyclopedias-almanacs-transcripts-and-maps/american-academy-forensic-sciences
American Academy of Forensic Sciences | Encyclopedia.com
American Academy of Forensic Sciences The American Academy of Forensic Sciences (AAFS) is a non-profit, professional organization founded in 1948 in an effort...
american academyforensic sciencesencyclopedia
https://www.sc.edu/study/colleges_schools/nursing/news/2018/faan-2018.php
UofSC Nursing alumni inducted as American Academy of Nursing Fellows - College of Nursing |...
Dr. Stephanie Burgess, Dr. Gwendolyn Childs and Jeannie Kelley Tomlinson were recognized during the AAN conference on November 3, 2018.
academy of fellowsnursing alumniuofscinductedamerican
https://www.flipsnack.com/aaapnewsletter/aaap_newsletter_fall_2022.html
AAAP_Newsletter_Fall_2022 by American Academy of Addiction Psy... - Flipsnack
Fall 2022 AAAP Newsletter
american academyaaapnewsletterfall
https://www.aafs.org/research/annual-conference-proceedings
Annual Conference Proceedings | American Academy of Forensic Sciences
Mar 2, 2026 - The Proceedings of the American Academy of Forensic Sciences is an official publication of the American Academy of Forensic Sciences (AAFS). It is devoted to...
annual conference proceedingsamerican academyforensicsciences
https://hearcareers.audiology.org/
American Academy of Audiology (AAA), HEARCareers|Find Your Career Here
American Academy of Audiology (AAA) - Find your next career at HEARCareers. Check back frequently as new jobs are posted every day.
american academy of audiologyfind your careeraaa
https://careercenter.njaap.org/
Pediatrics Jobs - The New Jersey Chapter, American Academy of Pediatrics
The New Jersey Chapter, American Academy of Pediatrics offers the top jobs available in Pediatrics. Search and apply to open positions or post jobs on The New...
new jersey chapterpediatrics jobsamerican academy
https://www.aale.org/
American Academy for Liberal Education
American Academy for Liberal Education - Advancing Excellence in Liberal Education
american academyliberaleducation
https://psychology.yale.edu/news/jennifer-richeson-elected-american-academy-arts-sciences?page=3
Jennifer Richeson elected to the American Academy of Arts & Sciences | Department of Psychology
the american academy
https://gaaap.org/
Home - Georgia Chapter American Academy of Pediatrics
Apr 24, 2026 - What does Georgia AAP offer? Explore advocacy, leadership, CME opportunities, and resources for pediatric care excellence.
georgia chapteramerican academypediatrics
https://home.dartmouth.edu/news/2025/11/american-academy-sciences-and-letters-inducts-three?tags=636&page=13
American Academy of Sciences and Letters Inducts Three | Dartmouth
academy of sciencesamericanlettersthreedartmouth
https://research.msu.edu/news/goldstein-poindexter-and-sullivan-receive-american-academy-nursing-honors
Goldstein, Poindexter, and Sullivan Receive American Academy of Nursing Honors | Office of Research...
american academy of nursing
https://netlab.cs.washington.edu/uncategorized/american-academy-of-arts-sciences
American Academy of Arts & Sciences : Mobile Intelligence Lab
academy of artsmobile intelligenceamericanscienceslab
https://www.wolterskluwer.com/en/solutions/ovid/jaaos--journal-of-the-american-academy-of-orthopaedic-surgeons-8266
Ovid - JAAOS - Journal of the American Academy of Orthopaedic Surgeons | Wolters Kluwer
The Journal of the American Academy of Orthopaedic Surgeons (JAAOS) is The Official Journal of the AAOS.
the american academyorthopaedic surgeonsovidjournal
https://connect.aafprs.org/home
Home - American Academy of Facial Plastic and Reconstructive Surgery
plastic and reconstructiveamerican academyfacialsurgery
https://med.ucf.edu/student-affairs/student-services/student-organizations-student-events/american-academy-of-developmental-medicine-dentistry-aadmd/
American Academy of Developmental Medicine & Dentistry (AADMD) - College of Medicine
american academydevelopmentalmedicinedentistrycollege
https://www.perio.org/
American Academy of Periodontology American Academy of Periodontology
Apr 30, 2026 - The American Academy of Periodontology (AAP) is a 7,500-member professional organization for periodontists. Learn more about gum health.
american academyperiodontology
https://discovery.fiu.edu/display/venue-0890-8567
Journal of the American Academy of Child and Adolescent Psychiatry
the american academychild and adolescentjournalpsychiatry
https://www.americanacademy.de/the-2020-21-class-of-berlin-prize-fellows/
The 2020-21 Berlin Prize Fellows - American Academy in Berlin
Sep 17, 2020 - Berlin Prize fellowships have been awarded to 21 US-based scholars, writers, and artists.
american academyberlinprizefellows
https://religion.arizona.edu/news/religious-studies-faculty-american-academy-religion-annual-meeting
Religious Studies Faculty at the American Academy of Religion Annual Meeting | Religious Studies
Three Religious Studies faculty members will be presenting at the 2014 American Academy of Religion Annual Meeting. Dr. Andrea McComb Sanchez will be...
american academy of religionreligious studiesat thefaculty
https://aachronym.blogspot.com/2007/12/american-academy-farewell-dinner.html
AACHRONYM: American Academy Farewell Dinner
The American Academy in Berlin hosted a farewell reception and dinner for the Fall 2007 Fellows, which formally marked the end of the Fall Q...
american academyfarewelldinner
https://www.aad.org/public?ref=missboux.com
American Academy of Dermatology | Public Education
Get expert insights into the care and treatment of your skin, hair, and nails for a lifetime of healthy habits.
american academydermatologypubliceducation
https://jonfleetwood.substack.com/p/american-academy-of-pediatrics-calls
American Academy of Pediatrics Calls for Eliminating Religious and Personal Belief Vaccine...
AAP has received over $345 million in taxpayer-funded grants and cooperative agreements from U.S. health agencies, including the CDC, HRSA, SAMHSA, NIH, and...
american academy
https://actu.epfl.ch/news/american-academy-of-arts-and-sciences-elects-gis-4/
American Academy of Arts and Sciences elects Gisou van der Goot - EPFL
academy of arts
https://asm.org/academy/american-academy-of-microbiology-leadership-nomina
American Academy of Microbiology Leadership Call for Volunteers | ASM.org
Call for volunteers for open American Academy of Microbiology leadership positions.
call for volunteersamerican academymicrobiologyleadershipasm
https://aasm.org/about/affiliated-sites/
Affiliated Sites - American Academy of Sleep Medicine
Feb 9, 2026 - Here is a list of the AASM's affiliated sites.
affiliated sitesamerican academysleepmedicine
https://aaplcp.org/
American Academy of Physician Life Care Planners - Home
life care plannersamerican academyphysician
https://www.aafs.org/membership/manage-status
Manage Your Membership Status | American Academy of Forensic Sciences
Oct 2, 2025 - Current AAFS members can use the links below to manage, upgrade, promote, or confirm their membership status. Members with retired or disabled status should...
manage your membershipamerican academystatusforensicsciences
https://digitalcollections.udel.edu/Documents/Detail/american-academy-of-arts-amp-sciences./71084
American Academy of Arts & Sciences. - University of Delaware Digital Collections
academy of artsamericansciencesuniversitydelaware