https://www.thinkwithgoogle.com/intl/en-emea/future-of-marketing/privacy-and-trust/research-customer-privacy-practices/
New Google research explores how brands can approach privacy. Discover practices marketers can adopt to keep customers in control and get better marketing...
consumer trustprivacybuildbrandthink
https://www.brickmarketing.com/blog/ai-brand-trust-signal
Dec 27, 2025 - AI now signals brand trust by showing modern capability transparency relevance and long term readiness in digital marketing.
brand trustbrick marketingaibecomesignal
https://www.shopify.com/my/blog/citizens-of-soil-growing-profits-and-purpose
How Citizens of Soil built a purpose-driven olive oil brand through refillables, ethical sourcing, and support for family-owned and women-led farms.
olive oilbuildingbrandfarmerstrust
https://webflow.com/blog/brand-messaging
Strategic brand messaging allows companies to communicate their values and build relationships with customers. Follow these 6 steps to develop a framework.
brand messagingkeystepscraftingframework
https://www.radicalcandor.com/podcast/cult-of-the-credo-7-36
When a company’s values don’t match its actions, the impact can be devastating. Behind Johnson & Johnson’s famous “Credo” lies a story of trust...
cultcredobelovedbrandbetrayed
https://www.snehagroup.in
Sneha Group is a diversified conglomerate with an exemplary backward integration. We are a household name in Andhra Pradesh and Telangana states and have...
bestpoultrybrandindiayears
https://www.edelman.com/research/covid-19-brand-trust-report
Edelman has just conducted a 12-market study on the critical role brands are expected to play during the coronavirus pandemic, completed on March 26. We...
trust barometerspecial reportcoronavirus pandemicbrand
https://www.name.com/blog/how-domain-name-security-builds-trust-and-credibility
Learn how securing your domain name enhances credibility, safeguards your market presence, and prevents financial loss. Find out key steps to prevent fraud so...
online brand protectiondomain name securitybuilds trust
https://www.ama.org/marketing-news/how-does-a-brand-regain-consumer-trust-after-a-crisis/
Read more about How Does a Brand Regain Consumer Trust After a Crisis? - from American Marketing Association
consumer trustbrandregaincrisis
https://www.bis.org/review/r180522a.htm
Speech by Mr Randal K Quarles, Vice Chairman for Supervision of the Board of Governors of the Federal Reserve System, at the "Ring-Fencing the Global Banking...
randalkquarlestrusteveryone
https://www.edelman.com/uk/trust/2025/trust-barometer/special-report-brands
Trust in brands has soared in recent years, with brands more trusted than any traditional institution we study. In an environment of economic pain,...
special reportbrand trustbarometer
https://cutt.ly/resources/blog/branded-short-links-trust-ctr
Discover why branded short links outperform generic URLs. Learn how custom domains and branded links increase trust, CTR and brand authority with Cuttly.
short linksbrandedmattertrustctr
https://www.printful.com/ca/blog/what-is-brand-awareness
Discover what brand awareness is and how to increase trust, website traffic, and recognition with proven strategies.
brand awarenesstipsboosttrusttraffic
https://www.qualtrics.com/support/survey-platform/common-use-cases-rc/covid-19-brand-trust-pulse/?utm_lp=related%2Bpage
brand trustcovidpulse
https://keap.com/small-business-automation-blog/customer-service/customer-experience/build-consumer-trust
Trust from your prospective customers can make or break you. Read more on how to build trust in your brand.
consumer truststepsbuildingbrandkeap
https://www.rebrandly.com/blog/tinyurl-alternatives
Sep 25, 2025 - Discover the best TinyURL alternatives with branded domains, analytics, and link editing. Compare free and paid options.
brand trusttinyurlalternativesboostclicks
https://www.involve.me/templates/trustradius-review-funnel
Encourage happy customers to leave positive reviews on TrustRadius with this guided funnel and turn customer satisfaction into social proof
trustradius reviewfunneltemplatebuildbrand
https://www.yieldify.com/blog/brand-trust-and-how-to-build-it/
Nov 17, 2022 - How do you grow brand trust online? Keep it honest, keep it consistent and keep it service-orientated. Click to find more tips for eCommerce brands!
brand trustgaincustomerconfidence
https://www.edelman.com/uk/research/edelman-trust-barometer-special-report-brand-trust-and-coronavirus-pandemic
Edelman conducted a 12-market study on the critical role brands are expected to play during the coronavirus pandemic, completed on March 26. We interviewed...
trust barometerspecial reportedelmanbrandcoronavirus
https://www.xbiz.com/features/293879/maintaining-brand-trust-in-the-face-of-negative-press
Over the last year, several of our merchants have found themselves caught up in litigation over compliance with state age verification laws. Recently, Segpay...
brand trustmaintainingfacenegativepress
https://www.qualtrics.com/support/pt-br/survey-platform/common-use-cases-rc/covid-19-brand-trust-pulse/
brand trustcovidpulse
https://yougov.com/articles/52384-brand-trust-falls-after-food-recalls-with-1-in-6-reporting-strong-impact
As food recalls rise across the US, new YouGov data reveals that 1 in 6 consumers report significant brand trust loss — even when few are directly affected....
brand trustfood recallsfalls
https://www.cision.com/resources/articles/forging-trust-in-age-of-skepticism/
In an era when consumers have more information at their fingertips than ever before, brand trust is one of the most valuable currencies a business can hold....
build trustbrand reputationstrengthenguide
https://www.surveymonkey.com/curiosity/brand-trust-logo-design-research-study/?dkfirstname=%20Cara&dksurveytitle=Iredell%20EDC%20%202019%20New%20Website%20Design%20-%20BURKE%20Agency%20Questionnaire&engagestate=Deployed&utm_source=email&utm_medium=sm_crm_mktg_pa&utm_content=survey.350998&utm_term=cont1_CTA&utm_campaign=RE_NL&date=2019-02-36&CID=102845518&cvosrc=email.responsys.SM_CRM_MKTG_PA.&cvo_cid=survey.350998&cont1_CTA
A look at which logo designs garner more trust from consumers, and how it varies by industry.
research studylogo designsbrand trustimpact
https://abmarketinggroup.co/how-professional-video-production-increases-brand-trust-and-conversion-rates/
Sep 5, 2025 - Did you know that 91% of consumers want to see more online video content from brands? Brands that use video not only engage their audience better, but also
professional video productionbrand trustconversion ratesincreases
https://www.5wpr.com/new/social-responsibility-in-martech-how-pr-builds-brand-trust/
Sep 26, 2025 - Learn how PR builds brand trust through ethical martech practices including transparent data use, sustainability communication, crisis management and social...
social responsibilitybrand trustmartechprbuilds
https://www.edelman.com/research/brand-trust-2020
The Edelman Trust Barometer Special Report: Brand Trust in 2020 reveals that brands face a fundamental reordering of priorities amid a global pandemic and...
trust barometerspecial reportbrandedelman
https://business.trustedshops.com/clients/the-chesterfield-brand-case-study
The Chesterfield Brand built trust in their Dutch, German, French, and English online shops with the help of Trusted Shops' solutions.
brand buildingchesterfieldtrusthelp
https://www.heqs.com.au/
HEQS offers exceptional furniture collections, modular solutions, and professional-grade pieces designed for residential, commercial, and wholesale sectors....
brandtrust
https://www.brandshelter.com/blog/how-phishing-attacks-erode-brand-trust/
Oct 20, 2025 - Learn how phishing attacks - from spoofed domains to fake ads - damage brand trust and what companies can do to prevent and recover from them.
phishing attacksbrand trusterode
https://www.cbsnews.com/brandstudio/news/securing-ai-building-trust-in-the-data-era/
As enterprises scale AI, security has become imperative. Cyera outlines why data security is essential to scaling AI with confidence.
securing aibuilding trustbrand studiodataera
https://dockyard.com/blog/2025/05/15/building-brand-trust-through-digital-transparency-and-security
Users are more cautious than ever about how their data is handled, and businesses that fail to prioritize transparency and security risk losing customer...
brand trustbuildingdigitaltransparencysecurity
https://adage.com/ad-age-video-podcast/marketers-brief/aa-life360-cmo-building-brand-trust-bold-creative/
Jan 7, 2026 - CMO Mike Zeman talks about how marketing is fueling Life360's evolution into a “family super app.”
brand trustcmomikezemanbold
https://rtl-adalliance.com/article/rtl-adalliances-tv-key-facts-2025-highlights-broadcasters-vital-role-shaping-brand-trust
Two in three Europeans consider brands that appear in long-form professional content most trustworthy, helping boost brands’ reputations.
tv keyvital rolertlfactshighlights
https://www.readersdigest.in/videos/rd-chronicles-the-role-of-trust-in-a-brand-building-journey-in-conversation-with-entrepreneur-and-content-creator-ankur-warikoo-127710
Feb 14, 2024 - What does it take to be a successful creator brand? How do the best content creators harness trust from a skeptical generation? Entrepreneur and author Ankur...
ankurroletrustbrand
https://inkandwater.co.uk/work/sheffield-rotherham-wildlife-trust/
Aug 29, 2025 - Ink & Water developed brand guidelines and later a website redesign for a great local institution – Sheffield & Rotherham Wildlife Trust.
brand guidelineswildlife trustsheffieldamprotherham
https://www.edelman.com/uk/research/trust-barometer-special-report-brand-trust-2020
The Edelman Trust Barometer Special Report: Brand Trust in 2020 reveals that brands face a fundamental reordering of priorities amid a global pandemic and...
trust barometerspecial reportbrandedelman
https://sproutsocial.com/insights/brand-trust/
Dec 9, 2025 - Learn why brand trust matters more than ever on social media, and the strategies you can use to communicate your brand activism.
brand trustsprout socialmatters
https://www.mlivemediagroup.com/trust-is-the-new-rate-why-brand-loyalty-wins-across-generations/
Aug 8, 2025 - Brand trust now beats products and rates. Boomers want consistency. Gen Z wants values. The best banks build trust through action not ads.
brand loyaltytrustnewratewins
https://www.ispot.tv/ad/wSgh/nexium-24hr-trust-the-brand-doctors-trust-for-their-own-frequent
In this animated spot, golden wires twist and turn to illustrate Nexium's message. The brand claims Nexium 24HR is the first choice of pharmacists and doctors...
tv spotnexiumtrustbranddoctors