https://www.enlightenedcapitalventures.biz/
Enlightened Capital Ventures – RE Investment Company
capital venturesenlightenedinvestmentcompany
https://blackcapitalventures.com/
Black Capital Ventures – High Tech Startup Advisory Partner
capital ventureshigh techstartup advisoryblackpartner
https://cjrcapitalventures.com/
CJR Capital Ventures, LLC - Multifamily Syndication
CJR Capital Ventures, LLC is a rеаl еѕtаtе invеѕtment аnd рrореrtу mаnаgеmеnt соmраnу with a fосuѕ оn multifаmilу properties.
capital venturescjrllcmultifamilysyndication
https://longevity.technology/news/longevity-technology-and-and-capital-ventures-launch-partnership/
Longevity.Technology and AND Capital Ventures launch partnership
May 5, 2026 - Strategic market intelligence partnership connects Longevity.Technology’s DLT platform with AND Capital’s operator-led investment strategy.
capital ventureslongevitytechnologylaunchpartnership
https://aurumcapitalventures.com/
Aurum Capital Ventures | #1 Provider for institutional Hashrate Investment
Mar 19, 2026 - Aurum Capital Ventures is a pioneer in the modular data center industry, providing forward-thinking investors with secure access to this emerging space
capital venturesaurumproviderinstitutionalhashrate
https://web3.capital/careers-1
Web3 Capital | Web3 Ventures | Web3 DAO | Web3 Accelerator
Web3 Capital | Web3 Ventures | Web3 DAO | Web3 Accelerator
capital venturesdaoaccelerator
https://www.startupreporter.eu/creative-capital-ventures/
Creative Capital Ventures Unveils €18M Fund to Transform Tech and Digital Media Sectors - Startup...
Oct 30, 2024 - Lisbon and London-based venture studio Creative Capital Ventures (CCV) has launched a new investment fund. The fund combines substantial financial backing with...
creative capitaldigital mediaventuresunveilsfund
https://www.mmcapitalventures.com/
M&M Capital Ventures | Financial Services | Delray Beach
capital venturesfinancial servicesdelraybeach
https://www.bundesverkehrsportal.de/bain-capital-ventures-raised-1-3-billion-to-fund-young-startups-and-young-vc-firms-too-techcrunch/
Bain Capital Ventures raised $1.3 billion to fund young startups, and young VC firms, too -...
Oct 3, 2021 - Bain Capital Ventures (BCV), the venture arm of the 37-year-old private equity firm Bain Capital, […]
bain capitalventuresraisedbillionfund
https://www.naturalcapitalventures.com/
Home Page Natural Capital Ventures Advice and Consultancy
Natural Capital Ventures is established in the Netherlands and works with nonprofits and small and medium sized business at home and abroad.
natural capitalventuresadviceconsultancy
https://gcvh.weebly.com/
GLOBAL CAPITAL VENTURES HOLDINGS - Home
GLOBAL CAPITAL VENTURES HOLDINGS
global capitalventuresholdings
https://www.hedgecapital.org/
Hedge Capital Ventures | Consulting Firm
capital ventureshedgeconsultingfirm
https://741capitalventures.com/
741 Capital Ventures - Multifamily Syndication
741 Capital Ventures is a rеаl еѕtаtе invеѕtment аnd рrореrtу mаnаgеmеnt соmраnу with a fосuѕ оn multifаmilу properties.
capital venturesmultifamilysyndication
https://archcapital.ventures/
Arch Capital Ventures – Private Equity Firm That Specializes in Real Estate
private equity firmcapital venturesarchspecializesreal
https://goldstonecapventures.com/
Goldstone Capital Ventures | Leading Private Real Estate Firm
Goldstone Capital Ventures is a premier private real estate firm specializing in developing and acquiring high-quality assets in prime locations. Build wealth...
private real estatecapital venturesgoldstoneleadingfirm
https://apexcapven.com/
Apex Capital Ventures – Where Vision Meets Capital
capital venturesapexvisionmeets
https://www.vccircle.com/tag/bain-capital-ventures
Latest Bain Capital Ventures News | Bain Capital Ventures News | Bain Capital Ventures Funding |...
Latest Bain Capital Ventures news, Bain Capital Ventures News, Bain Capital Ventures Funding, Bain Capital Ventures Fund and articles about Bain Capital...
bain capitallatestventuresnewsfunding
https://www.pxnventures.co.uk/
PXN Ventures | Venture Capital & Investment for the North
Nov 24, 2025 - PXN Ventures is the leading venture capital firm for the North of England, Scotland, and NI. We provide "more than money" support to high-growth founders.
ventures venture capitalpxninvestmentnorth
https://octopusventures.com/
Octopus Ventures | Venture Capital
Mar 12, 2026 - We provide venture capital investment for the people, ideas and industries that will change the world. Learn about what we do and the kind of founders we back.
ventures ventureoctopuscapital
https://menlovc.com/
Menlo Ventures | Early-Stage Venture Capital Firm
Dec 9, 2025 - Menlo Ventures is an early-stage venture capital firm that invests across AI, consumer, enterprise, and healthcare technologies.
ventures early stagemenlocapitalfirm
https://www.av.vc/
Invest in Startups | Venture Capital Access for Individuals | Alumni Ventures - Alumni Ventures
Access curated startup investment opportunities and diversified venture capital exposure designed for accredited investors.
venture capitalinveststartupsaccessindividuals
https://cleanenergyventures.com/
Clean Energy Ventures | Climate Tech Venture Capital
Mar 18, 2026 - Clean Energy Ventures invests in scalable early-stage climate tech startups and clean energy technologies addressing global climate change.
climate tech ventureclean energyventurescapital
https://resilientventures.org/
Resilient Ventures – Expanding Access To Capital for African Americans
expanding accessresilientventurescapitalafrican
https://6thman.ventures/
6th Man Ventures | Builder-First Capital
6MV is a thesis-driven crypto focused investment firm backing the world's most tenacious founders.
manventuresbuilderfirstcapital
https://www.goldengate.vc/
Golden Gate Ventures | Venture Capital for Southeast Asia
Golden Gate Ventures is a global, early-stage venture capital firm that empowers audacious founders across 3 continents. Founded in 2011, Golden Gate Ventures...
ventures venture capitalgolden gatesoutheastasia
https://www.arboretumvc.com/
Midwest Healthcare Venture Capital Firm | Arboretum Ventures
Mar 31, 2026 - For over 20 years we have been a successful healthcare venture capital firm rooted in the Midwest. Check out our portfolio companies.
venture capital firmmidwesthealthcarearboretumventures
https://www.vccircle.com/btomorrow-ventures-multipoint-capital-invest-in-ai-solutions-firm-paralleldots
Btomorrow Ventures, Multipoint Capital invest in AI solutions firm ParallelDots
Artificial intelligence startup ParallelDots, which offers advanced image recognition solutions, on Monday said it has raised a Series A funding of...
capital investai solutionsventuresmultipointfirm
https://goalventurepartners.com/
Goal Ventures | Venture Capital for Games and Digital Media
ventures venture capitalgoalgamesdigitalmedia
https://www.finsmes.com/2025/04/saison-capital-bri-ventures-coinvestasi-launches-tokenize-indonesia-a-rwa-startup-accelerator.html
Saison Capital, BRI Ventures & Coinvestasi Launches Tokenize Indonesia - a RWA Startup Accelerator
May 7, 2025 - Saison Capital, BRI Ventures, and Coinvestasi have officially launched Tokenize Indonesia, a new accelerator program aimed at identifying and supporting...
saisoncapitalbriventureslaunches
https://hashgraphvc.com/
Hashgraph Ventures | AI & Blockchain Venture Capital
ventures aihashgraphblockchaincapital
https://www.rachelzoeventures.com/
Rachel Zoe Ventures | Venture Capital | West Hollywood
Rachel Zoe Ventures is an early stage venture capital firm focused on disruptive consumer technology platforms and solutions.
ventures venture capitalrachel zoewesthollywood
https://www.yamahamotor.vc/
Yamaha Motor Ventures | Global Venture Capital Firm in Silicon Valley
Yamaha Motor Ventures is investing in early stage startups that are changing the world of Mobility, AgTech, and HealthTech.
global venture capitalyamaha motorventuresfirmsilicon
https://pwv.com/
PWV | Early stage capital for technology founders | Preston-Werner Ventures
PWV (Preston-Werner Ventures) is a Silicon Valley venture capital firm led by Tom Preston-Werner. We back category-defining companies from zero to breakout.
early stagecapitaltechnologyfounderspreston
https://idventures.com/
ID Ventures - Early-Stage Capital from Invest Detroit
Mar 12, 2026 - ID Ventures scales promising early-stage ventures into thriving companies that help support the state’s economy, provide jobs to local talent, and bolster...
ventures early stageidcapitalinvestdetroit
https://www.arthurventures.com/
Arthur Ventures | Early Growth Capital Firm | Arthur Ventures
Arthur Ventures is an early growth capital firm that leads investments in B2B software companies in every region of the U.S. and Canada.
ventures earlygrowth capitalarthurfirm
https://baincapitalventures.com/insight/why-we-re-doubling-down-on-maintainx/
Why We’re Doubling Down on MaintainX | Bain Capital Ventures
Dec 15, 2025 - MaintainX is reimagining industrial workflows for the AI era and is fast becoming the system of record for physical operations.
bain capitaldoublingmaintainxventures
https://rhiaventures.org/rhcapital/
RH Capital - Rhia Ventures
rh capitalrhiaventures
https://citizensventures.com/projects
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://baincapitalventures.com/team/tom-dotan/
Tom Dotan | Strategic Team Member & Results-Driven Pro | Bain Capital Ventures
Discover Tom Dotan, a results-driven professional focused on impact and collaboration. Learn how Tom can support your goals—connect with him today.
team memberresults drivenbain capitaltomdotan
https://www.beyondcapitalventures.com/
Beyond Capital Ventures
beyond capitalventures
https://citizensventures.com/cities/tijuana
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://industryventures.durkancloud.net/
Industry Ventures - Collaborative and Innovative Venture Capital Platform
Mar 3, 2025 - Industry Ventures has cultivated new segments of the venture capital market for over two decades using its complete lifecycle approach.
venture capitalindustryventurescollaborativeinnovative
https://baincapitalventures.com/insight/the-answer-to-our-it-service-desk-woes-moveworks/
Moveworks + ServiceNow: AI ITSM acquisition news | Bain Capital Ventures
Apr 20, 2026 - Discover how Moveworks and ServiceNow transform ITSM with AI-driven ticket resolution. Learn more about the acquisition and see what’s next.
ai itsmacquisition newsbain capitalmoveworksservicenow
https://altventures.ca/
ALT VENTURES – Canada's Top Pre-Seed Venture Capital Firm for Entrepreneurs & Communities
venture capital firmtop prealtventurescanada
https://www.onehundred.vc/
Creativity is the future of capital | One Hundred Ventures
If you've built something worth copying, we make sure you get paid when they do. One Hundred is an IP firm and venture studio that protects, monetizes, and...
capital onecreativityfuturehundredventures
https://citizensventures.com/about
About Citizens Ventures | Citizen Capital Network
Learn about the Citizen Capital Network—a democratic economic funding model enabling local citizens to participate in structured growth capital for real...
citizens venturescapitalnetwork
https://venturecapitalcareers.com/companies/cvx-ventures
CVX Ventures | Venture Capital Careers
CVX is one of Europe's fastest growing venture investors and is executing on our path to become Europe’s largest venture investor by providing high growth...
ventures venture capitalcvxcareers
https://adirvc.com/
Adir Ventures - Venture Capital, Private Equity, Seed Investing
Venture capital, Private Equity, and Seed Investing.
ventures venture capitalprivate equityadirseedinvesting
https://tiventures.ch/
Ti-Ventures – High-Tech seed capital
Venture Capital – Lugano, Switzerland
high techtiventuresseedcapital
https://aprilvc.com/
April Ventures - Pre-Seed Capital Ventures Firm
ventures pre seedaprilcapitalfirm
https://www.fog.ventures/
FOG Ventures | Venture Capital
FOG connects founders with operator investors who deliver customers, talent, and strategic advisory. Over 3,000 introductions made to help startups scale.
ventures venturefogcapital
https://freeflow.zone/
FreeFlow Ventures — Execution First. Capital After.
We diagnose what is broken in your startup, fix it with you, and connect you to capital only after proof.
first capitalfreeflowventuresexecution
https://citizensventures.com/cities/seoul
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://www.lumiraventures.com/login/
Login - Lumira Ventures | Venture Capital Life Sciences | Canada
lumira ventures venturecapital life sciencescanada
https://psymed.ventures/
PsyMed Ventures - Frontier Brain and Mental Health Venture Capital Fund
Mar 7, 2026 - We are a venture fund investing in frontier brain and mental health: neurotech, precision psychiatry, novel therapeutics, digital therapeutics, holistic...
mental healthventure capitalventuresfrontierbrain
https://venturecapitalcareers.com/companies/thomson-reuters-ventures/jobs/summer-analyst-corporate-venture-capital-fund-internship
Summer Analyst, Corporate Venture Capital Fund Internship at Thomson Reuters Ventures • New York,...
Thomson Reuters Ventures is hiring a Summer Analyst, Corporate Venture Capital Fund Internship in New York, United States - Apply now on Venture Capital...
corporate venture capitalthomson reuterssummeranalystfund
https://citizensventures.com/projects/franchises
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://www.magmatic.ventures/index.html
MAGMATIC VENTURES - Venture Capital für Start-ups
Magmatic Ventures bietet Venture Capital Finanzierung für Start-ups und unterstützt Gründer mit Netzwerk und Know-how.
ventures venture capitalstartups
https://www.prnewswire.com/news-releases/collaborative-robotics-raises-30m-series-a-backed-by-sequoia-capital-khosla-ventures-and-mayo-clinic-launches-flywheel-program-301885727.html
COLLABORATIVE ROBOTICS RAISES $30M SERIES A BACKED BY SEQUOIA CAPITAL, KHOSLA VENTURES, AND MAYO...
Jul 26, 2023 - /PRNewswire/ -- Collaborative Robotics, a leader in the development of practical collaborative robots (cobots), today announced it has raised $30M in Series...
collaborative roboticsraisesseriesbackedsequoia
https://www.questventures.com/businesses/venture-capital/
Venture Capital - Quest Ventures
Aug 14, 2024 - Driving the digital economy across Asia. Quest Ventures back early-stage companies and is usually the catalyst they need to disrupt their industry.
venture capitalquestventures
https://www.baeventures.com/en/how-we-work/our-approach/
Our Approach - How We Work - BAE Ventures - Venture Capital
ventures ventureapproachworkbaecapital
https://www.av.vc/institutional
Institutional Capital & Alumni Ventures - Alumni Ventures
institutionalcapitalalumniventures
https://growthventures.capitalone.com/
Home | Capital One Ventures
Capital One Ventures is a strategic investor, harnessing the potential of startups to accelerate innovation.
capital oneventures
https://www.kensho.vc/
Kensho Ventures | European Deep-Tech Venture Capital
European deep-tech VC. EUR 500K first checks, hands-on infrastructure from Day 1. Investing in robotics, cybersecurity, quantum, and industrial AI.
european deep techkenshoventurescapital
https://mobilityventures.com/
Mobility Ventures | Venture Capital for Disruptive Technology Startups
ventures venture capitaldisruptive technologymobilitystartups
https://www.sicaventures.com/
Sica Ventures - Capital & Advisory
Sica Ventures is an early stage investment company based in Columbus, OH and the DC Metro area.
ventures capitalsicaadvisory
https://www.agmcapitalventures.com/
ACCESS | AGM Capital Ventures
We deliver value through thoughtful site selection, disciplined execution, and a strong alignment with investor objectives. Our leadership brings more than...
accessagmcapitalventures
https://baincapitalventures.com/newsletter/
Newsletter | Bain Capital Ventures
Bain Capital Ventures helps founders build iconic businesses that transform the way we live and work.
bain capitalnewsletterventures
https://www.nextbold.vc/
Next Bold Ventures - Operational Capital for Bold Visions
Jan 25, 2023 - Next Bold Ventures invests and provides operational expertise to founders to turn bold ideas into great companies across Asia Pacific.
nextboldventuresoperationalcapital
https://baincapitalventures.com/insight/these-are-2024s-top-50-vertical-saas-startups/
Top 50 Vertical SaaS Startups to Watch in 2024 | Bain Capital Ventures
Apr 20, 2026 - Discover 2024’s top 50 vertical SaaS startups transforming AEC, logistics, legal and finance with AI. Explore the list and find your next partner.
vertical saasbain capitaltopstartupswatch
https://capitallab-ventures.com/
Capital Lab Ventures | Venture Capital
capitallabventures
https://baincapitalventures.com/team/abby-meyers/
Abby Meyers: Growth Stage Software Investor | Bain Capital Ventures
Meet Abby Meyers, investor in growth stage application software across the US and Europe. Discover her approach to founders and investing today.
growth stagebain capitalabbymeyerssoftware
https://www.bdevventures.com/
BDEV Ventures | Capital + Lead Generation
May 22, 2026 - We invest venture capital and our Lead Generation Platform to accelerate Growth for B2B Startups.
ventures capitalleadgeneration
https://citizensventures.com/how-it-works
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://www.graphitevc.com/philosophy/
Our focus in Canada's venture capital | Graphite Ventures
Oct 20, 2025 - We are specialists at seed stage growth, helping founders build capital-efficient businesses that scale. Learn why we are the most trusted seed vc in Canada
venture capitalfocuscanadagraphiteventures
https://menlovc.com/focus-areas/cybersecurity/
Menlo Ventures | Cybersecurity Venture Capital Firm
Feb 16, 2026 - Menlo Ventures, a leading cybersecurity venture capital firm, partners with early-stage startups developing innovative, AI-native security solutions.
menlo venturescybersecuritycapitalfirm
https://www.venturesplatform.com/stories/venture-capital-as-a-catalyst-driving-africas-transformation-through-investment-in-innovation
Ventures Platform | Venture Capital as a Catalyst: Driving Africa’s Transformation Through...
ventures platformcapitalcatalystdrivingtransformation
https://www.vanterra.com/
Vanterra | Ventures & Capital
Vanterra is a multi-strategy investment fund that manages assets for a diverse investor base of ultra-high net worth partners and leading institutions.
vanterraventurescapital
https://menlovc.com/focus-areas/infrastructure/
Menlo Ventures | Infrastructure Venture Capital Firm
Feb 16, 2026 - Menlo Ventures invests in the infrastructure that powers AI and the cloud. We provide capital, guidance, and expertise to help infrastructure startups achieve...
menlo venturesinfrastructurecapitalfirm
https://www.aiconicventures.com/
AI & Deep Tech Venture Capital | AICONIC VENTURES
Nov 10, 2025 - AICONIC VENTURES is an AI and deep tech venture capital firm investing in the latest tech innovations. Connect with us to scale your breakthrough idea.
ai deep techventure capitalventures
https://vcwire.tech/2026/04/23/pegasus-tech-ventures-and-japanet-extend-corporate-venture-capital-fund-to-us200m/
Pegasus Tech Ventures and Japanet Extend Corporate Venture Capital Fund to US$200M
Apr 23, 2026 - Pegasus Tech Ventures, a global venture capital firm focused on startup investments and corporate innovation, expanded its corporate venture capital (CVC) fund...
corporate venture capitaltech venturespegasusextendfund
https://capitalmarketventures.com/
About - Capital Market Ventures
Oct 27, 2023 - Mr. Darwin J. Bruce is a business leader, author, speaker, and corporate lawyer. Check out his book "The Map to Entrepreneurship: Your Complete Guide To Being...
capital marketventures
https://tcvegypt.com/
TCV - Tanmiya Capital Ventures
Jun 30, 2025 - Tanmiya Capital Ventures (“TCV”), founded in 2016, is an Egypt-based investment management firm specializing in growth equity investments guided by impact
tcvcapitalventures
https://citizensventures.com/cities/tokyo
Citizens Ventures — Building cities with citizens, capital, and trust
Citizens Ventures brings together local citizens, structured capital, and turnkey development projects to support the long-term growth of cities worldwide.
citizens venturesbuilding citiescapitaltrust
https://www.tysonfoods.com/innovation/food-innovation/tyson-ventures
Tyson Ventures: Our Food Venture Capital Firm | Tyson Foods
Tyson Ventures is the venture capital firm of Tyson Foods changing the food industry through food technology, emerging sources of protein and sustainable...
venture capital firmtysonventuresfood
https://vesaliusventures.com/
A venture capital firm created for diversified investments | Vesalius Ventures
Vesalius Ventures is a venture capital firm dedicated to accelerating the future of medicine by becoming the premier conduit for enabling technologies that...
venture capital firmcreateddiversifiedinvestmentsvesalius
https://baincapitalventures.com/domain/app/
AI Apps: Agentic AI for High-Impact Productivity | Bain Capital Ventures
Discover how AI apps and agentic AI transform workflows, boost productivity, and power tech-enabled services. Learn more and start building today.
ai appshigh impactbain capitalagenticproductivity
https://baincapitalventures.com/domain/healthcare/
AI-Powered Healthcare: Transparent, Personalized Care | Bain Capital Ventures
Discover how AI-powered healthcare transforms access, cuts costs, and improves outcomes with transparent, personalized care. Explore the future of health.
ai powered healthcarebain capitaltransparentpersonalizedventures
https://baincapitalventures.com/team/nicole-lorusso/
Nicole Falasco: Apps Go-to-Market & Growth Partner | Bain Capital Ventures
Discover how Nicole Falasco helps apps portfolio companies scale with strategic buyer, channel and acquirer relationships. Connect to grow faster.
market growthbain capitalnicoleappsgo
https://eandiventuresllc.com/
E and I Ventures – Capital and Counselling for Early Stage and Startup Technology Firms
early stage startupventurescapitalcounsellingtechnology
https://hawkeyeprivateventures.com/
Hawkeye Private Ventures - Private Capital for Real Estate Investors
Hawkeye Private Ventures is a dynamic corporation with specialized divisions offering tailored Business Financial Solutions, Innovative Software, CRM...
ventures capitalreal estatehawkeyeprivateinvestors
https://backswingventures.com/
Defense & National Security Venture Capital | Backswing Ventures
Mar 19, 2026 - An early-stage venture firm investing in defense and national security technologies, backing founders building mission-critical companies.
defense national securityventure capitalventures
https://ammpcapital.com/
Private Investment Firm Backing High-Growth Ventures | AMMP Capital
AMMP Capital is a purpose-driven investment firm supporting founders and scaling ventures across real estate, consumer, health, and tech.
private investment firmhigh growthbackingventuresammp
https://www.gr33nbase.io/
GR33NBASE | Access to & Capital for GreenTech Funds and Ventures
We leverage regulated digital assets and token economic principles to mobilize private capital and broaden access to the promising asset class of greentech...
accesscapitalgreentechfundsventures
https://baincapitalventures.com/insight/vc-insights-2025-ai-trends-startup-growth-and-2026-predictions/
VC Insights 2025: AI Trends, Startup Growth and 2026 Predictions | Bain Capital Ventures
Dec 18, 2025 - Bain Capital Ventures partners reflect on this year's biggest shifts, market surprises, and what they think is coming next in 2026.
ai trendsstartup growthbain capitalvcinsights