https://pubmed.ncbi.nlm.nih.gov/25553684/
Clinical efficacy of polyherbal formulation Eezpain spray for muscular pain relief
The topical herbal formulation Eezpain spray consisting of natural ingredients that have been clinically proved for its analgesic and anti-inflammatory...
clinical efficacymuscular painformulation
https://pubmed.ncbi.nlm.nih.gov/15988423/
Clinical efficacy of racemic albuterol versus levalbuterol for the treatment of acute pediatric...
There was no difference in clinical improvement in children with acute moderate to severe asthma exacerbations treated with either racemic albuterol or...
clinical efficacy
https://eprints.soton.ac.uk/423781/
Clinical efficacy of eplerenone versus placebo for central serous chorio-retinopathy: study...
clinical efficacy
https://pubmed.ncbi.nlm.nih.gov/35492261/
Biological mechanisms and clinical efficacy of sulforaphane for mental disorders
Current clinical management of major mental disorders, such as autism spectrum disorder, depression and schizophrenia, is less than optimal. Recent scientific...
clinical efficacybiologicalmechanismssulforaphanemental
https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2019.01977/full
Frontiers | Clinical Efficacy and Adverse Effects of Antibiotics Used to Treat Mycobacterium...
Treatment of Mycobacterium abscessus pulmonary infection requires long-term administration of multiple antibiotics. Little is known, however, about the impac...
clinical efficacyadverse effects
https://experts.umn.edu/en/publications/increasing-the-clinical-efficacy-of-nk-and-antibody-mediated-canc/
Increasing the clinical efficacy of NK and antibody-mediated cancer immunotherapy: Potential...
clinical efficacy
https://pmc.ncbi.nlm.nih.gov/articles/PMC12169039/
Clinical Efficacy of Electroacupuncture in the Treatment of Chronic Neck Pain: A Randomized...
Chronic neck pain (CNP) is a common but challenging symptom in clinical practice. Acupuncture is widely used in alleviating the symptoms of CNP. The main...
chronic neck painclinical efficacythe treatment
https://pmc.ncbi.nlm.nih.gov/articles/PMC12401265/
Clinical efficacy of selenium supplementation in patients with Hashimoto thyroiditis: A systematic...
To assess the clinical benefits of Selenium (Se) supplementation in patients with Hashimoto thyroiditis (HT). Eight databases were searched for randomized...
clinical efficacy
https://cordis.europa.eu/project/id/101003595/es
Exploration of safety, tolerability and clinical efficacy of Solnatide IMP in patients infected...
Clinical features of patients infected with the 2019-nCoV have revealed that these patients suffer from severe respiratory failure, and presence of a...
clinical efficacy
https://scholars.duke.edu/publication/760981
Scholars@Duke publication: Clinical efficacy of taxane-trastuzumab combination regimens for...
clinical efficacyscholarsdukepublication
https://pubmed.ncbi.nlm.nih.gov/25074856/
Clinical efficacy of fidaxomicin compared with vancomycin and metronidazole in Clostridium...
Fidaxomicin provides improved sustained cure rates in patients with CDI compared with vancomycin. An indirect comparison indicates that the same is also true...
clinical efficacyfidaxomicincompared
https://pubmed.ncbi.nlm.nih.gov/33434384/
Clinical efficacy and safety of omalizumab in conventional treatment-resistant vernal...
Clinical efficacy and safety of omalizumab in conventional treatment-resistant vernal keratoconjunctivitis: Our experience and literature review
efficacy and safetyconventional treatmentclinical
https://www.frontiersin.org/journals/oncology/articles/10.3389/fonc.2022.997894/full
Frontiers | Comparison of clinical efficacy of single-incision and traditional laparoscopic surgery...
AbstractBackground: Single-incision laparoscopy surgery (SILS) is a new laparoscopic technique that has emerged in the past decade. Whether it has advantages...
clinical efficacysingle incisionfrontierscomparison
https://pubmed.ncbi.nlm.nih.gov/12006732/
Clinical efficacy of piracetam in cognitive impairment: a meta-analysis
A meta-analysis has been performed including nineteen double blind, placebo controlled studies with piracetam in patients suffering from dementia or cognitive...
clinical efficacycognitive impairmentpiracetammetaanalysis
https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0198852
Assessment of the clinical efficacy of the heart spectrum blood pressure monitor for diagnosis of...
Atrial fibrillation (AF) is the most common arrhythmia. The most common diagnostic method, 12-lead electrocardiogram (ECG), can record episodes of arrhythmia...
blood pressure monitorof theclinical efficacy
https://pubmed.ncbi.nlm.nih.gov/27216216/
Clinical efficacy of daratumumab monotherapy in patients with heavily pretreated relapsed or...
The efficacy and favorable safety profile of daratumumab monotherapy in multiple myeloma (MM) was previously reported. Here, we present an updated pooled...
clinical efficacy
https://pmc.ncbi.nlm.nih.gov/articles/PMC11027290/
Clinical efficacy of motion-insensitive imaging technique with deep learning reconstruction to...
To demonstrate that a T2 periodically rotated overlapping parallel lines with enhanced reconstruction (PROPELLER) technique using deep learning reconstruction...
clinical efficacy
https://www.qk.sjtu.edu.cn/jter/EN/10.3969/j.issn.1673-0364.2016.06.011
The Clinical Efficacy of Hyaluronic Filling in the Treatment of Facial Wrinkles
Objective To evaluate the clinical efficacy of hyaluronic filling in t...
clinical efficacyhyaluronicfillingtreatmentfacial
https://pmc.ncbi.nlm.nih.gov/articles/PMC6065210/
Pharmacokinetics, Safety, and Clinical Efficacy of Cannabidiol Treatment in Osteoarthritic Dogs -...
Objectives: The objectives of this study were to determine basic oral pharmacokinetics, and assess safety and analgesic efficacy of a cannabidiol (CBD) based...
clinical efficacypharmacokineticssafety
https://pmc.ncbi.nlm.nih.gov/articles/PMC5783144/
A review of the pharmacology and clinical efficacy of brivaracetam - PMC
Brivaracetam (BRV; Briviact) is a new antiepileptic drug (AED) approved for adjunctive treatment of focal (partial-onset) seizures in adults. BRV is a...
a reviewof theclinical efficacypharmacologybrivaracetam
https://www.frontiersin.org/journals/medicine/articles/10.3389/fmed.2024.1463041/full
Frontiers | Clinical efficacy of Endostar continuous infusion combined with concurrent...
Objective: To evaluate the effectiveness and safety of concurrent chemoradiotherapy using Endostar continuous infusion for treating oesophageal squamous cell...
clinical efficacyfrontiersendostarcontinuousinfusion
https://pubmed.ncbi.nlm.nih.gov/31271830/
Susceptibility profiles and clinical efficacy of antifungals against candida bloodstream isolates...
In vitro and clinical data were analysed to evaluate the susceptibility profile of itraconazole in light of the new cut-off points. The in vitro activity of...
clinical efficacysusceptibilityprofiles
https://pubmed.ncbi.nlm.nih.gov/7803523/
Clinical efficacy of gamma-hydroxybutyric acid in treatment of opiate withdrawal
This paper describes the role of gamma-hydroxybutyric acid (GHB) in the treatment of opiate withdrawal syndrome. In the two patients described, after having...
clinical efficacygammaacidtreatmentopiate
https://eprints.ncl.ac.uk/80782
Cholinergic mechanisms of psychosis and clinical efficacy of cholinergic drugs - ePrints -...
clinical efficacycholinergicmechanismspsychosisdrugs
https://pubmed.ncbi.nlm.nih.gov/34252308/
Why Remdesivir Failed: Preclinical Assumptions Overestimate the Clinical Efficacy of Remdesivir for...
Remdesivir is a nucleoside monophosphoramidate prodrug that has been FDA approved for coronavirus disease 2019 (COVID-19). However, the clinical efficacy of...
clinical efficacyremdesivirfailedpreclinicalassumptions
https://pubmed.ncbi.nlm.nih.gov/1597547/
Present status of eyelid phototherapy. Clinical efficacy and transmittance of ultraviolet and...
The combined clinical experience and transmittance data suggest that eyelid phototherapy is a safe and effective treatment in selected patients.
clinical efficacypresentstatuseyelidphototherapy
https://www.frontiersin.org/journals/cellular-and-infection-microbiology/articles/10.3389/fcimb.2025.1532289/full
Frontiers | Antifungal susceptibility and clinical efficacy of chlorhexidine combined with topical...
ObjectiveThis study investigated the susceptibility of various Fusarium fungi to five topical antifungal agents: natamycin, voriconazole, chlorhexidine, nata...
clinical efficacyfrontiersantifungalsusceptibility
https://pubmed.ncbi.nlm.nih.gov/30450088/
Clinical Efficacy and Microbiome Changes Following Fecal Microbiota Transplantation in Children...
Fecal microbiota transplantation (FMT) has been shown as an effective treatment for recurrent clostridium difficile infection (RCDI) in adults. In this study,...
clinical efficacymicrobiomechanges
https://pubmed.ncbi.nlm.nih.gov/25823275/
[Clinical efficacy of arbidol (umifenovir) in the therapy of influenza in adults: preliminary...
It was found that the effect of umifenovir in the treatment of influenza in adults is most pronounced in the acute stage of the disease and appears in the...
clinical efficacythe therapyarbidol
https://pmc.ncbi.nlm.nih.gov/articles/PMC11100965/
Advancements in Dermatological Applications of Curcumin: Clinical Efficacy and Mechanistic Insights...
Curcumin, derived from Curcuma longa (turmeric), exhibits significant potential in dermatology, addressing conditions like atopic dermatitis, psoriasis,...
clinical efficacyadvancementsdermatologicalapplications
https://pmc.ncbi.nlm.nih.gov/articles/PMC8837848/
Clinical Efficacy of the 940-nm Diode Laser in the Treatment of Recurrent Pockets in the...
Introduction: The basis of periodontal treatments is the mechanical removal of bacterial biofilm, which is often not sufficient. Therefore, laser therapy can...
clinical efficacyof the
https://experts.arizona.edu/en/publications/a-study-of-the-clinical-efficacy-of-maintenance-ect/
A study of the clinical efficacy of maintenance ECT - University of Arizona
a studyof theclinical efficacymaintenanceect
https://www.frontiersin.org/journals/surgery/articles/10.3389/fsurg.2025.1546873/full
Frontiers | Comparison of clinical efficacy between proximal femoral locking plate and cannulated...
ObjectiveThe objective of this study is to investigate the clinical efficacy of proximal femoral locking plates in comparison to cannulated compression screw...
clinical efficacy
https://pubmed.ncbi.nlm.nih.gov/22131755/
Clinical efficacy of Mehamudgara vati in type 2 diabetes mellitus
In type 2 diabetes, insulin resistance is the main problem that is associated with a cluster of conditions such as obesity and hyperlipidemia. The present...
clinical efficacyvatitypediabetes
https://clinicaltrials.med.nyu.edu/cancer/clinicaltrial/1371/phase-3-randomized-double-blind/?section=elg&qd=36222595
A Phase 3 Randomized Double-blind Matching Placebo-controlled Clinical Trial to Study the Efficacy...
New life-saving treatments for Urinary Bladder Neoplasms in clinical trial on A Phase 3 Randomized Double-blind Matching Placebo-controlled Clinical Trial to...
https://pmc.ncbi.nlm.nih.gov/articles/PMC5418665/
Clinical and bacteriological efficacy of twice daily topical retapamulin ointment 1% in the...
Cutaneous bacterial infections are common in children and adults and frequently are caused by Staphylococcus aureus (S. aureus). Treatment failures with...
https://pmc.ncbi.nlm.nih.gov/articles/PMC9547202/
A randomized clinical trial to test efficacy of chamomile and saffron for neuroprotective and...
Depression is one of the common psychiatric problems in growing world population caused by long-term stressful events that may trigger the down regulation of...
https://grants.nih.gov/grants/guide/NOSIs_targetingList.cfm?GuideDocID=34791
PAR-21-132 - Confirmatory Efficacy Clinical Trials of Non-Pharmacological Interventions for Mental...
https://grants.nih.gov/grants/guide/pa-files/PAR-21-132.html
Expired PAR-21-132: Confirmatory Efficacy Clinical Trials of Non-Pharmacological Interventions for...
NIH Funding Opportunities and Notices in the NIH Guide for Grants and Contracts: Confirmatory Efficacy Clinical Trials of Non-Pharmacological Interventions for...
https://pubmed.ncbi.nlm.nih.gov/41408522/
Efficacy of modified versus standard Valsalva maneuvers on clinical outcomes and satisfaction of...
PACTR202407479098909. Registered 15/07/2024.
https://www.cirm.ca.gov/clinical-trial/clinical-study-to-assess-safety-and-efficacy-of-subretinal-injection-of-human-neural-progenitor-cells-for-treatment-of-retinitis-pigmentosa/
Clinical Study to Assess Safety and Efficacy of Subretinal Injection of Human Neural Progenitor...
safety and efficacy
https://pmc.ncbi.nlm.nih.gov/articles/PMC12538989/
Natural relief for premenstrual syndrome (PMS): a double-blind clinical trial on the efficacy and...
Premenstrual syndrome (PMS) is a prevalent and often debilitating health conditions affecting women of reproductive age. The natural PMSoff supplement contains...
https://pubmed.ncbi.nlm.nih.gov/37548312/
Effect of fucoidan on gut microbiota and its clinical efficacy in Helicobacter pylori eradication:...
Fucoidan considerably improved gut dysbiosis during SQT for H. pylori eradication. Gut microbiota can be maintained by the addition of fucoidan before...
https://scholars.uky.edu/es/projects/a-study-to-evaluate-the-clinical-and-microbial-efficacy-of-06-isv-2/
A Study to Evaluate the Clinical and Microbial Efficacy of 0.6% ISV-403 Compared to Vehicle in the...
https://researchconnect.buffalo.edu/en/publications/clinical-efficacy-effects-on-mri-and-tolerability-of-weekly-intra/
Clinical efficacy, effects on MRI and tolerability of weekly intramuscular interferon-beta-1a in...
https://pmc.ncbi.nlm.nih.gov/articles/PMC8076052/
The clinical efficacy and safety of single-agent pembrolizumab in patients with recurrent granulosa...
Treatment of recurrent, unresectable granulosa cell tumor (GCT) of the ovary can be challenging. Given the rarity of the tumor, alternative therapies have been...
https://clinicaltrials.med.nyu.edu/clinicaltrial/2305/single-center-randomized-clinical-trial/?section=contact&qd=36154892
A single-center randomized clinical trial to test the efficacy of pharyngeal swallowing exercises...
New life-saving treatments for pre-frail older adults in clinical trial on A single-center randomized clinical trial to test the efficacy of pharyngeal...
https://pmc.ncbi.nlm.nih.gov/articles/PMC8211334/
A Randomized, Double-blind, Placebo-controlled Clinical Study Investigating the Efficacy and...
Clinical Trial ID: NCT0454597 BACKGROUND: Mimetic wrinkles, commonly referred to as expression lines, form perpendicular to anatomical regions subjected to...
double blind
https://pmc.ncbi.nlm.nih.gov/articles/PMC3202256/
A clinical study to assess the efficacy of Triyushnadi Anjana in Kaphaja Abhishyanda with special...
Vernal keratoconjunctivitis / spring catarrh is a variety of exogenous allergic conjunctivitis, which is a very troublesome ocular disease of childhood and in...
https://adisinsight.springer.com/trials/700197647?error=cookies_not_supported&code=29f45ff8-fbd3-4b00-b91a-c4143d7c5cd3
Clinical Efficacy of Probiotic Bacteria in Subjects With Irritable Bowel Syndrome (IBS), Functional...
This trial is investigating the efficacy of probiotic bacteria [Lactobacillus acidophilus + Bifidobacterium lactis] in patients with functional bowel disorders
irritable bowel syndrome ibs
https://adisinsight.springer.com/trials/700381520?error=cookies_not_supported&code=5f1f499a-6ed6-49fe-8ea2-4ea7f98e7835
Clinical Study Evaluating the Safety and Efficacy of IC19 CAR-T Cell Therapy for Refractory...
This study is an open label, single arm exploratory clinical trial of IC19 CAR-T cell therapy for refractory systemic lupus erythematosus. Patients who are
https://portal.fis.tum.de/en/publications/clinical-efficacy-of-sars-cov-2-omicron-neutralizing-antibodies-i/
Clinical efficacy of SARS-CoV-2 Omicron-neutralizing antibodies in immunoglobulin preparations for...
https://adisinsight.springer.com/trials/700391559?error=cookies_not_supported&code=0e91f717-b721-4ec5-92cb-2fd5803c961e
An Open-label, Multicenter Clinical Study on The Long-term Safety and Efficacy of Multiple...
This is an open-label, multicenter, phase III clinical study to evaluate the long-term safety and efficacy of multiple treatments with recombinant botulinum
https://pmc.ncbi.nlm.nih.gov/articles/PMC8722640/
A Systematic Review of the Clinical Efficacy of Micro-Focused Ultrasound Treatment for Skin...
The demand for non-invasive skin-tightening techniques is continuously on the rise, as now numerous patients seek safe and effective alternative body, neck,...
https://pubmed.ncbi.nlm.nih.gov/34145528/
The Pharmacology and Clinical Efficacy of Antiseizure Medications: From Bromide Salts to Cenobamate...
Epilepsy is one of the most common and disabling chronic neurological disorders. Antiseizure medications (ASMs), previously referred to as anticonvulsant or...
https://adisinsight.springer.com/trials/700358246?error=cookies_not_supported&code=89e9ea60-8cd2-4418-a954-615a4ab44912
Clinical Research for Efficacy and Safety of Zanubrutinib in Maintenance Therapy of DLBCL Patients...
This trial is a single-center, single-arm, prospective clinical study to investigate the efficacy and safety of zanubrutinib maintenance therapy in patients
efficacy and safety
https://pubmed.ncbi.nlm.nih.gov/18173095/
Efficacy of lycopene in the treatment of gingivitis: a randomised, placebo-controlled clinical trial
The results presented in this study suggest that lycopene shows great promise as a treatment modality in gingivitis. The possibility of obtaining an additive...
https://adisinsight.springer.com/trials/700391586?error=cookies_not_supported&code=d944a11c-6542-4de5-8d67-f7d91ea42abe
Phase 3 Clinical Study on the Efficacy and Safety of SBRT Combined With Becotatug Vedotin (MRG003)...
The combination of local consolidative treatment for oligometastases and systemic therapy offers the potential for clinical cure and significantly prolongs
https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCT00375674&r=1
A Clinical Trial Comparing Efficacy And Safety Of Sunitinib Versus Placebo For TheTreatment Of...
A Clinical Trial Comparing Efficacy And Safety Of Sunitinib Versus Placebo For TheTreatment Of Patients At High Risk Of Recurrent Renal Cell Cancer
efficacy and safety
https://experts.mcmaster.ca/scholarly-works/1619823
Efficacy of Electronic Clinical Decision Support...
Learn about the scholarly work entitled Efficacy of Electronic Clinical Decision Support...
efficacyelectronicclinicaldecisionsupport
https://clinicaltrials.med.nyu.edu/cancer/clinicaltrial/264/phase-ii-clinical-trial/?qd=29810228
A Phase II Clinical Trial to Study the Efficacy and Safety of Pembrolizumab (MK-3475) and...
New life-saving treatments for High risk, non-muscle invasive bladder cancer in clinical trial on A Phase II Clinical Trial to Study the Efficacy and Safety of...
https://adisinsight.springer.com/trials/700049414?error=cookies_not_supported&code=9fb63160-f5a0-43cb-89a6-8c65d4497870
A Phase 3, Multi-Center, Randomized, Placebo-Controlled Study to Evaluate the Clinical Efficacy and...
This trial investigated the efficacy and tolerability of abatacept in patients with active Crohn's disease. This trial consisted of two parts, an induction
https://adisinsight.springer.com/trials/700391797?error=cookies_not_supported&code=fbfebf5f-39ee-453f-be0d-be42433ca85f
Clinical Study on the Efficacy and Safety of Iparomlimab and Tuvonralimab Injection Combined With...
Major objectives to evaluate the efficacy and safety of Iparomlimab and Tuvonralimab Injection (QL1706,an Anti-PD-1/CTLA-4 Combined Antibody) combined with
efficacy and safety
https://pmc.ncbi.nlm.nih.gov/articles/PMC11869035/
Clinical efficacy of Methylene Blue mediated antimicrobial Photodynamic Therapy (PDT) using 680 nm...
Inflammatory periodontal disease caused by dental plaque is characterised by the clinical signs of inflammation and loss of periodontal tissue support. The...
photodynamic therapy pdt