https://eng.obozrevatel.com/section-war/newsamp-tanks-shells-and-air-defence-systems-german-company-rheinmetall-is-ready-to-produce-weapons-in-ukraine-09-05-2023.html
Tanks, shells and air defence systems: German company Rheinmetall is ready to produce weapons in...
The concern is currently trying to conclude the relevant agreements | OBOZ.UA
air defenceready totanksshellssystems
https://www.defenceconnect.com.au/industry/16977-skyranger-35-air-defence-systems-supplied-to-ukraine
Skyranger 35 air defence systems supplied to Ukraine - Defence Connect
Oct 13, 2025 - An undisclosed number of Skyranger 35 air defence systems will be supplied to Ukraine by German arms manufacturers Rheinmetall.
air defenceto ukrainesystemssuppliedconnect
https://www.eurasiantimes.com/trump-admiistration-stuns-turkey-says-return-s-400-get-access-to-patriot-air-defence-systems/
Trump Admiistration Stuns Turkey; Says Return S-400 & Get Access To Patriot Air Defence Systems
Mar 11, 2020 - The US has shocked Ankara by declaring that Turkey must return S-400 systems back to Russia if it is keen to procure Patriot air defence systems. This was...
get accessair defencetrumpturkeysays
https://english.bombaysamachar.com/international/china-preparing-manpads-iran-us-intelligence-cnn-report-ceasefire/
Is China Helping To Deliver MANPADS Air Defence Systems To Iran ? US Intelligence Reports | English...
Apr 11, 2026 - US intelligence indicates China may deliver shoulder-fired MANPADS to Iran within weeks amid fragile ceasefire. Beijing denies claims, per CNN report.
air defenceiran usintelligence reportschinahelping
https://www.zawya.com/en/economy/gcc/uae-air-defence-systems-engage-12-ballistic-missiles-three-cruise-missiles-four-uavs-on-monday-d7jqtid6
UAE air defence systems engage 12 ballistic missiles, three cruise missiles, four UAVs on Monday
Since the onset of the blatant Iranian attacks on the UAE, the air defences have engaged a total of 549 ballistic missiles, 29 cruise missiles, and 2,260 UAVs
air defenceballistic missileson mondayuaesystems
https://www.rusi.org/explore-our-research/publications/rusi-defence-systems
RUSI Defence Systems | Royal United Services Institute
Concise briefings on strategic, conceptual and acquisition issues faced by the global defence community, designed for analysts and practitioners
rusi defence systemsroyalunitedservicesinstitute
https://moen.nidec.com/cs-CZ/drives/news-and-media/news/articles/2023/07/05/drives-in-flood-defence-systems
Nidec Drives | Drives in flood defence systems
nidec drivesflood defencesystems
https://www.securityinfowatch.com/alarms-monitoring/alarm-systems-intrusion-detection/sensors-detectors-infrared/company/10215640/wylam-defence-systems-limited
Wylam Defence Systems Limited | Security Info Watch
Manufactures portable and fixed ground surveillance equipment and smoke and light intruder-deterrent systems.
defence systemssecurity infowylamlimitedwatch
https://www.dynamicdefencesystems.com/
Home | Dynamic Defence Systems
defence systemsdynamic
https://www.careers-page.com/c4isolutions/job/QW7R96VW/apply
Technology Specialist Defence Systems - C4i Solutions | Career Page
Be you with us, shape the future of Defence and Technology C4i Solutions delivers end-to-end ICT and cyber security solutions, from concept through to...
technology specialistdefence systemscareer pagesolutions
https://www.egyptindependent.com/tag/air_defence_systems/
air defence systems Archives - Egypt Independent
air defenceegypt independentsystemsarchives
https://thisisbeirut.com.lb/news/73286/air-defence-systems-sirens-sound-in-kyiv-after-trump-putin-call-afp
Air defence systems, sirens sound in Kyiv after Trump-Putin call: AFP
Air defence systems, sirens sound in Kyiv after Trump-Putin call: AFP
air defencesystemssirenssoundkyiv
https://www.muni.cz/vyzkum/publikace/2347363
Identification of phage defence systems targeting other viruses infecting bacterial hosts |...
defence systemsother virusesidentificationtargetingbacterial
https://www.middleeasteye.net/news/saudi-arabia-deploy-own-missile-defence-system-oil-facilities-us-withdraw-patriot-batteries
Saudi Arabia to deploy its own missile-defence systems at oil facilities after US withdrawal |...
Some US officials feel that Iran 'no longer poses an immediate threat to American strategic interests'
saudi arabiamissile defenceafter usdeploysystems
https://menafn.com/1111064497/Swiss-Government-Evaluates-Alternative-Air-Defence-Systems
Swiss Government Evaluates Alternative Air-Defence Systems
Swiss Government Evaluates Alternative Air-Defence Systems. The Swiss government is pursuing the acquisition of an additional long-range air defence system,...
air defenceswissgovernmentalternativesystems
https://www.indiandefensenews.in/2025/02/thales-and-bharat-dynamics-ltd-agree-on.html
Thales And Bharat Dynamics Ltd Agree On Initial Supply of Man Portable Air Defence Systems To India...
Thales and Bharat Dynamics Limited (BDL) will provide a first supply of Laser Beam Riding MANPAD (LBRM) Very Short Range Air Defence (VSHORA...
bharat dynamicsportable airdefence systemsthalesltd
https://defencereviewasia.com/tag/nasams-air-defence-systems/
NASAMS air defence systems Archives - Defence Review Asia
air defencesystemsarchivesreviewasia
https://umimpact.umt.edu/en/publications/author-correction-a-functional-selection-reveals-previously-undet/
Author Correction: A functional selection reveals previously undetected anti-phage defence systems...
defence systemsauthorcorrectionfunctionalselection
https://www.distillintelligence.com/news/advanced-cyber-defence-systems
Advanced Cyber Defence Systems (ACDS) News
May 9, 2026 - ACDS launched Deep Field Analytics, signed CISA's Secure by Design Pledge, and issued critical alerts regarding major European data breaches.
cyber defenceacds newsadvancedsystems
https://kyivindependent.com/bild-germany-considers-supplying-iris-t-surface-to-air-defence-systems-to-ukraine/
Bild: Germany considers supplying IRIS-T surface-to-air defence systems to Ukraine.
Jun 23, 2022 - German daily Bild reported, citing a security source, that the German cabinet's security council was discussing the possibility of sending the systems made by...
air defencebildgermanyconsiderssupplying
https://www.biglive.com/news/international/iron-dome-arrow-davids-sling-why-israels-air-defence-systems-are-making-headlines-amid-conflict-with-iran
Iron dome arrow davids sling why israels air defence systems are making headlines amid conflict...
Mar 2, 2026 - Israel-Iran Conflict: One thing that is always in the news in military conflicts between Israel and its rival countries is its state-of-the-art multi-layered...
iron domeair defencemaking headlinesarrowdavids
https://sputnikglobe.com/20220407/china-protests-over-us-approval-of-taiwan-deal-on-patriot-air-defence-systems-1094543093.html
China Protests Over US Approval of Taiwan Deal on Patriot Air Defence Systems - 07.04.2022, Sputnik...
On Wednesday, the US said Taiwan would be able to use the proposed training and equipment as a "deterrent to regional threats and to strengthen homeland......
air defencechinaprotestsusapproval
https://www.trtworld.com/article/15498771
US activates deployment of defence systems 'throughout' Mideast - TRT World
US will send a Terminal High Altitude Area Defense system and additional Patriot air defence missile system battalions to Middle East, says Pentagon.
defence systemstrt worldusactivatesdeployment
https://ricerca.uniba.it/handle/11586/62457
Antagonistic effect of beauvericin and T-2 toxin co-occurence on antioxidant defence systems in...
defence systemseffecttoxincoantioxidant
https://tfiglobalnews.com/tag/defence-systems/
defence systems Archives - TFIGlobal
defence systemsarchivestfiglobal
https://thepressunited.com/india/india-neutralises-pakistani-drone-missile-attacks-targets-air-defence-systems-2/
India neutralises Pakistani drone, missile attacks; targets air defence systems - The Press United
May 8, 2025 - Indian Armed Forces has issued a statement following the events of 07-08 May, outlining the sequence of actions and responses under Operation SINDOOR. During a...
air defencethe pressindiapakistanidrone
https://publicatt.unicatt.it/handle/10807/179128
The US initiatives in the field of the hypersonic weapons and the related defence systems: a point...
the ushypersonic weaponsdefence systemsinitiativesfield
https://euro-sd.com/2020/03/allgemein/16545/inner-layer-defence-systems-new-developments-against-anti-ship-cruise-missiles-and-asymmetric-threats/
Inner Layer Defence Systems New Developments Against Anti-Ship Cruise Missiles and Asymmetric...
Mar 10, 2020 - In recent decades, navies worldwide and the global defence industry have started to tackle the new airborne, missile and surface threats. The latter has...
defence systemsnew developmentscruise missilesinnerlayer
https://www.edrmagazine.eu/mbda-signs-enhancements-for-italian-air-defence-systems-based-on-camm-er-with-occar
MBDA signs enhancements for Italian air defence systems based on CAMM-ER with OCCAR - EDR Magazine
May 22, 2024 - MBDA, a world-leader in the field of complex weapon systems, has signed a contract amendment with OCCAR (the organisation for joint
air defencebased onedr magazinembdasigns
https://www.belganewsagency.eu/belgium-to-buy-polish-portable-air-defence-systems
Belgium to buy Polish portable air defence systems
May 13, 2025 - Belgium and Poland are set to deepen their military cooperation. According to a statement from the Polish ministry of Defence, the agreement...
to buyportable airdefence systemsbelgiumpolish
https://en.lb.ua/news/2023/05/25/20538_lithuania_announces_new_aid_package.html
Lithuania announces new aid package for Ukraine including air defence systems ammunition
The country's military aid will soon reach 465m euros.
air defencelithuaniaannouncesnewaid
https://navyleaders.com/exhibitor/msi-defence-systems-ltd/
MSI-Defence Systems Ltd - Navy Leaders
defence systemsmsiltdnavyleaders
https://sputniknews.in/20260420/russian-air-defence-systems-shoot-down-112-ukrainian-drones-mod-10777898.html
Russian Air Defence Systems Shoot Down 112 Ukrainian Drones: MoD - 20.04.2026, Sputnik India
Russian air defence forces destroyed 112 Ukrainian drones overnight, the Russian Defence Ministry said. 20.04.2026, Sputnik India
air defencerussiansystemsshootukrainian
https://tacticalstarsandstripes.com/will-america-send-patriot-air-defence-systems-to-ukraine-deliveries-may-bring-major-risks-for-modest-gain/
Will America Send Patriot Air Defence Systems to Ukraine? Deliveries May Bring Major Risks For...
Dec 2, 2022 - The United States is reportedly considering transferring Patriot missile systems to the Ukrainian Military, which would mark an unprecedented provision of
air defenceto ukraineamericasendpatriot
https://news.cgtn.com/news/2025-07-07/news-1EO0thYYMKs/p.html
The IDF has identified that a missile was launched from Yemen towards Israel, and defence systems...
defence systemsidfidentifiedmissilelaunched
https://en.redtram.com/news/community/612332268/
Zelenskyy says Ukraine received NASAMS air defence systems from USA - Redtram
However, they are not enough for Ukraine to protect civilian infrastructure.
air defencefrom usazelenskyysaysukraine
https://www.msi-dsl.com/
Home - MSI Defence Systems
World leading capability in defence systems
defence systemsmsi
https://archives.bodleian.ox.ac.uk/repositories/2/archival_objects/579016
Marconi Defence Systems, 1987 | Bodleian Archives & Manuscripts
defence systemsmarconiarchivesmanuscripts
https://defence-industry.eu/switzerland-evaluates-additional-air-defence-systems/
Switzerland evaluates additional air defence systems
May 3, 2026 - The Swiss Federal Government is evaluating options to acquire an additional long-range air defence system to complement its existing Patriot order.
air defenceswitzerlandadditionalsystems
https://segoldmine.ppi-int.com/node/45058
Def Stan 00-56: "Safety Management Requirements for Defence Systems": Part No: 2: Guidance on...
def stansafety managementfor defencerequirementssystems
https://polen.itu.edu.tr/entities/publication/7e01380f-b2a1-413f-b49f-c7292e76f77a
Target priority based optimisation of radar resources for networked air defence systems
Abstract Air Defence System (ADS) effectiveness relies not only on weapon and sensor performances but also on effective usage of those resources. In an ADS...
resources forair defencetargetprioritybased
https://currentaffairs.adda247.com/top-10-air-defence-systems-in-the-world-ranked-list/
Top 10 Air Defence Systems in the World (Ranked List)
Dec 16, 2025 - Top 10 Air Defence Systems in the World explained with range, altitude, uses, and comparison table. Covers S-500, S-400, THAAD, Iron Dome, Barak-8 and more.
in the worldair defenceranked listtopsystems
https://www.kongsberg.com/about-us/management-and-organisation/defence-systems/
Defence Systems division - KONGSBERG - an international technology group
This division focuses on land systems, air and coastal defence, naval systems and advanced defence solutions.
defence systemstechnology groupdivisionkongsberginternational
https://ukdefencejournal.org.uk/leonardo-signs-agreement-for-danish-navy-defence-systems/
Leonardo signs agreement for Danish Navy defence systems
Jun 14, 2020 - The agreement is worth up to a total value of 70 million Euros.
danish navydefence systemsleonardosignsagreement
https://www.vaielettrico.it/tag/rafael-advanced-defence-systems/
Rafael Advanced Defence Systems Archivi - Vaielettrico
defence systemsrafaeladvancedarchivi
https://securitybrief.news/tag/defence-systems
Defence Systems Stories - SecurityBrief US
A list of all Defence Systems stories - SecurityBrief US.
defence systemsstoriesus
https://www.prnewswire.co.uk/news-releases/ground-based-ballistic-missile-defence-systems-market-report-2016-2026-568453661.html
Ground Based Ballistic Missile Defence Systems Market Report 2016-2026
ballistic missile defencemarket reportgroundbasedsystems
https://careers.promoteq.com/
Shaping the future of security & defence systems - Promoteq
shaping the futuredefence systemssecurity
https://a47news.ai/story/c_74c52f7eeb347a09
UAE Air Defence Systems Intercept Iranian Missile and Drone Attacks | A47 News
Apr 2, 2026 - On April 2, 2026, UAE air defence systems successfully intercepted missiles and drones launched from Iran, prompting emergency alerts across major cities. This...
air defencedrone attacksuaesystemsintercept
https://socialkandura.com/tag/air-defence-systems/
air defence systems Archives - Social Kandura
The best of everything Around Middle East
air defencesystemsarchivessocialkandura
https://channellife.in/tag/defence-systems
Defence Systems Stories - ChannelLife India
A list of all Defence Systems stories - ChannelLife India.
defence systemsstoriesindia
https://www.gov.uk/government/publications/guidance-on-the-export-licensing-of-man-portable-defence-systems-manpads
Guidance on the export licensing of Man-Portable Defence Systems (MANPADs) - GOV.UK
How the UK government interprets Wassenaar Arrangements
on thedefence systemsgov ukguidanceexport
https://www.pacb.com/publications/genome-directed-analysis-of-prophage-excision-host-defence-systems-and-central-fermentative-metabolism-in-clostridium-pasteurianum/
Genome-directed analysis of prophage excision, host defence systems, and central fermentative...
Jul 7, 2019 - Clostridium pasteurianum is emerging as a prospective host for the production of biofuels and chemicals, and has recently been shown to directly consume...
defence systemsgenomedirectedanalysisprophage
https://www.smgconferences.com/defence/archive/3-2005/conference/air-defence-systems
Air Defence Systems : Defence & Security : All
air defencesystemssecurity
https://datacenternews.ca/tag/defence-systems?page=2
Defence Systems Stories - Page 2 - DataCenterNews Canada
A list of all Defence Systems stories - DataCenterNews Canada.
defence systemsstories pagecanada
https://www.straitstimes.com/world/europe/russia-to-deploy-latest-air-defence-systems-in-crimea
Russia to deploy latest air defence systems in Crimea | The Straits Times
Jul 15, 2016 - MOSCOW (AFP) - Russia will deploy its most advanced S-400 air defence systems to the annexed Crimea peninsula in August, a military official said Friday (July...
the straits timesair defencerussiadeploylatest
https://www.dailymaverick.co.za/article_tag/air-defence-systems/
air defence systems | Daily Maverick
Articles tagged with air defence systems on Daily Maverick
air defencesystemsdailymaverick
https://caliber.az/en/post/russia-to-upgrade-tor-air-defence-systems-after-middle-east-experience
Russia to upgrade Tor air defence systems after Middle East experience | Caliber.Az
May 20, 2026 - Russia plans to upgrade its Tor short-range surface-to-air missile systems based on lessons learned from recent conflicts in the Middle East. Military analysts...
air defencemiddle eastrussiaupgradetor
https://hammermindset.com/tag/gulf-defence-systems/
Gulf defence systems - Hammer Mindset
defence systemsgulfhammermindset
https://defence.csg.com/en/products?type=land-systems
Products | CSG Defence Systems
defence systemsproductscsg
https://www.army-technology.com/news/newsroyal-thai-army-selects-rheinmetall-to-supply-air-defence-systems-4774943/
Royal Thai Army selects Rheinmetall to supply air defence systems - Army Technology
Jan 11, 2016 - Rheinmetall Defence has received a contract to supply air defence systems to the Royal Thai Army.
royal thaiair defencesystems technologyarmyselects
https://kashmirenglish.pk/air-defence-systems-activated-in-tehran/
Air defence systems activated in Tehran: Iranian media
Apr 23, 2026 - Air defence systems were activated in different areas of Iran's capital, Tehran, on Thursday evening amid the continuous mediation efforts
air defencesystemsactivatedtehraniranian
https://defencetechnologyinsights.com/tag/shipborne-laser-warning-systems/
Shipborne laser warning systems - Defence Technology Insights
warning systemsdefence technologylaserinsights
https://www.aviationpros.com/aircraft-maintenance-technology/aircraft-technology/defense/news/53069498/bae-systems-buys-us-defence-giant-ball-aerospace-in-56-billion-deal
BAE Systems Buys US Defence Giant Ball Aerospace in $5.6 Billion Deal | Aviation Pros
British defense contractor BAE Systems said it has signed a multi-billion dollar deal to buy a company which supplies parts to the James Webb telescope and the...
bae systemsball aerospaceusdefencegiant
https://www.icicidirect.com/research/equity/trending-news/bel-secures-569-cr-defence-electronics-orders-covering-avionics-warfare-systems-and-subsystems
bel secures 569 cr defence electronics orders covering avionics warfare systems and subsystems |...
belcrdefenceelectronicsorders
https://www.india.com/business/apollo-micro-systems-to-setup-integrated-plant-for-ingenious-defence-systems-signs-agreement-with-sbi-6827923/
Apollo Micro Systems to Setup Integrated Plant for Ingenious Defence Systems, Signs Agreement with...
Apr 1, 2024 - Earlier, Telangana Minister for Industries and Commerce and Legislative Affairs Duddilla Sridhar Babu Garu laid the foundation stone of the facility, named...
micro systemsapollosetupintegratedplant
https://www.rpsgroup.com/for-victoria/meet-our-people/scott-richardson-training-the-next-generation-of-systems-engineers/
Meet the RPS senior systems engineer behind some of Australia's most serious defence initiatives. |...
RPS Melbourne's Scott Richardson discusses his work on some of Australian's most important defence projects.
senior systems engineermeet thesome ofrpsbehind