https://www.aarpdriversafety.org/
Online Defensive Driving Course From AARP Driver Safety
The Smart Driver course from AARP is the nation's leading driver safety course. Upon completion, you may qualify for an auto insurance discount.
defensive drivingdriver safetyonlinecourseaarp
https://www.nbcsports.com/nfl/profootballtalk/rumor-mill/news/chiefs-defensive-backs-coach-dave-merritt-arrested-charged-with-domestic-battery
Chiefs defensive backs coach Dave Merritt arrested, charged with domestic battery - NBC Sports
Apr 23, 2026 - Chiefs defensive backs coach Dave Merritt has been arrested and charged with misdemeanor domestic battery.
nbc sportschiefsdefensivebackscoach
https://www.aol.com/articles/iran-willing-share-defensive-capabilities-075459757.html
Iran willing to share defensive capabilities with Asian partners, deputy defence minister says - AOL
Apr 28, 2026 - DUBAI, April 28 (Reuters) - Iran is ready to share its defensive weapons capabilities with
willing to shareirandefensivecapabilitiesasian
https://funnyboneschools.com/
Home - Funny Bones Defensive Driving School
Apr 2, 2026 - Best Online Driving Safety Course In Texas We’ve helped over 2 million students dismiss tickets! Dismiss Your Traffic Tickets for ONLY $25 REGISTER See How it...
defensive drivingfunnybonesschool
https://www.nfl.com/videos/cameron-heyward-joins-the-insiders-ahead-of-the-2026-nfl-draft
Pittsburgh Steelers defensive tackle Cameron Heyward joins 'The Insiders' ahead of the 2026 NFL...
Apr 22, 2026 - Pittsburgh Steelers defensive tackle Cameron Heyward joins
pittsburgh steelersthe insidersdefensivetacklecameron
https://sputnikglobe.com/20251201/nato-suggests-preemptive-strikes-against-russia-could-be-defensive-1123203878.html
NATO Suggests 'Preemptive Strikes' Against Russia Could Be 'Defensive'
NATO may consider launching a preemptive strike in the face of Russia's alleged actions against the alliance, Adm. Giuseppe Cavo Dragone, the chair of NATO's...
natosuggestsstrikesrussiacould
https://www.45fasttrafficschool.com/
45 Fast Traffic School | Defensive Driving Course, Driving Lessons, DUI Course
traffic schooldefensive drivingfastcourselessons
https://www.nfl.com/videos/byron-murphy-brings-down-maye-for-seahawks-6th-sack-of-super-bowl-lx
Seattle Seahawks defensive tackle Byron Murphy brings down New England Patriots quarterback Drake...
Feb 9, 2026 - Seattle Seahawks defensive tackle Byron Murphy II engulfs New England Patriots quarterback Drake Maye for a 4-yard sack in the fourth quarter of Super Bowl LX.
new england patriotsseattle seahawksdefensivetacklebyron
https://www.baltimoresun.com/2026/04/18/bengals-get-star-defensive-tackle-dexter-lawrence-from-giants-for-10th-pick-and-extend-him/
Bengals get star defensive tackle Dexter Lawrence from Giants for 10th pick and extend him –...
Apr 19, 2026 - By ROB MAADDI The Cincinnati Bengals have acquired three-time Pro Bowl defensive tackle Dexter Lawrence from the New York Giants for the 10th overall pick in...
dexter lawrencebengalsgetstardefensive
Sponsored https://fantasy.ai/
Create, Chat, and Connect with Your Perfect AI Companion - Fantasy.ai
Upgrade your Fantasy with a next-level AI Companion Platform. Create, Chat, and Connect. Your Fantasy, your Way!
https://www.icann.org/en/contracted-parties/generic-top-level-domains/rules-for-intellectual-property-defensive-registration-challenge-policy-25-02-2012-en
Rules for Intellectual Property Defensive Registration Challenge Policy
Rules for Intellectual Property Defensive Registration Challenge Policy. Administrative proceedings for the resolution of disputes under the Intellectual...
intellectual propertydefensive registrationruleschallengepolicy
Sponsored https://www.fanvue.com/
Fanvue
The creator subscription platform for the future. Sign up before the end of the month and take home 85%.
https://www.tampabay.com/sports/bucs/2026/04/27/bucs-pick-up-5th-year-option-defensive-tackle-calijah-kancey/
Bucs pick up 5th-year option for defensive tackle Calijah Kancey
Apr 27, 2026 - The former first-round draft pick has missed 22 games in three seasons.
pick upbucs5thyearoption
https://www.nfl.com/videos/can-t-miss-play-99-yard-pick-six-sydney-brown-goes-length-of-field-for-score
Can't-Miss Play: 99-YARD pick-six! Philadelphia Eagles defensive back Sydney Brown goes length of...
Sep 30, 2025 - Philadelphia Eagles defensive back Sydney Brown snatches his first career interception off of a pass from Arizona Cardinals quarterback Kyler Murray and...
philadelphia eaglesmissplayyardpick
https://proambitions.com/articles/offensive-and-defensive-mindset-for-all-players/
Offensive and Defensive Mindset For All Players - Pro Ambitions Hockey, Inc.
Oct 16, 2025 - Learn all skills Learn all positions as a youth player especially Have you ever heard the saying Forecheck Backcheck Paycheck Forwards who go hard to help the...
for alloffensivedefensivemindsetplayers
https://www.japantimes.co.jp/sports/2026/04/21/basketball/nba/wembanyama-defensive-player-of-year/
Wembanyama unanimously named NBA defensive player of the year - The Japan Times
Apr 21, 2026 - France international Victor Wembanyama, a generational talent who has helped transform San Antonio into title contenders, earned a perfect 100 votes in the...
namednbadefensiveplayeryear
https://www.complex.com/sports/a/jose-martinez/bam-adebayo-should-have-won-defensive-player-of-the-year-over-gobert-smart
Bam Adebayo Believes He Should Have Won Back-to-Back Defensive Player of the Year Over Rudy Gobert...
Feb 28, 2023 - Bam Adebayo explains why the last two Defensive Player of the Year award recipients—Marcus Smart and Rudy Gobert—should not have been chosen over him.
back torudy gobertbambelievesdefensive
https://www.baltimoreravens.com/video/ravens-rayshaun-benny-michigan-draft-day-3
Ravens Select Michigan Defensive Lineman Rayshaun Benny
Apr 25, 2026 - Watch the Ravens select Michigan defensive lineman Rayshaun Benny in the seventh round of the 2026 NFL Draft.
rayshaun bennyravensselectmichigandefensive
https://www.sbnation.com/nfl/24481304/nfl-defensive-rookie-of-the-year-odds-betting-david-bailey-rueben-bain
NFL Defensive Rookie of the Year odds with 2 favorites and appealing long-shot options | SB Nation
Apr 28, 2026 - Here are the odds for NFL Defensive Rookie of the Year.
long shotsb nationnfldefensiverookie
https://www.buccaneers.com/video/antoine-winfield-jr-wins-2026-pro-bowl-defensive-mvp-highlight
Bucs Antoine Winfield Jr. Named 2026 Pro Bowl Defensive MVP | Highlight
Feb 4, 2026 - Watch as Tampa Bay Buccaneers safety Antoine Winfield Jr. wins 2026 Pro Bowl MVP after the NFC's 66-52 victory over the AFC in San Francisco, California.
bucsantoinewinfieldjrnamed
Sponsored https://flirttendre.com/
FlirtTendre
Dating that finally gets you.
https://americansafetyinstitute.com/
Traffic School & Defensive Driving Course Online | American Safety - American Safety Institute
traffic schooldefensive drivingcourseonlineamerican
https://www.skysports.com/football/video/16622/13536072/goal-c-wood-31-sunderland-0-2-nottm-forest
Sunderland vs Nottingham Forest | Chris Wood gifted Forest's second goal after defensive howler |...
Apr 24, 2026 - Chris Wood extends Nottingham Forests lead at Sunderland in the first half.
nottingham forestchris woodsunderlandvsgifted
https://www.bengals.com/photos/2026-nfl-draft-defensive-back-prospects-nfl-draft-photos
2026 NFL Draft Defensive Back Prospects | NFL DRAFT PHOTOS
Apr 8, 2026 - Take a look at some of the top defensive back prospects in the 2026 NFL Draft.
2026 nfl draftdefensivebackprospectsphotos
https://www.quarkslab.com/
Offensive and Defensive Security Solutions
security solutionsoffensivedefensive
https://www.nfl.com/videos/cowboys-select-caleb-downs-with-no-11-pick-in-2026-draft
Dallas Cowboys select defensive back Caleb Downs with No. 11 pick in 2026 draft
Apr 24, 2026 - The Dallas Cowboys select Ohio State defensive back Caleb Downs in Round 1 of the 2026 NFL Draft with the No. 11 overall pick (via a trade with the Miami...
dallas cowboyscaleb downsselectdefensiveback
https://www.nbcsports.com/fantasy/baseball/news/fantasy-baseball-steals-report-agustin-ramirez-is-a-defensive-liability-and-jose-ramirez-is-age-less
Fantasy Baseball Steals Report: Agustín Ramírez is a defensive liability and José Ramírez is...
Apr 22, 2026 - Who is stealing bases, who isn't, why, and how.
fantasy baseballstealsreportdefensiveliability
https://opendorse.com/profile/jabrayan-richburg
Jabrayan Richburg, Defensive End, Minnesota State University Mankato Mavericks - NIL Profile -...
Jabrayan Richburg's Opendorse Profile. Deal marketplace for autographs, shoutouts, social posts and more. Support your favorite athlete today.
minnesota state universitydefensiveendmankatomavericks
Sponsored https://ehentai.ai/
The Best AI Hentai Art Generator - eHentai.ai
Are you looking to create AI hentai? At eHentai.ai you can make unique AI generated hentai art and images!
https://www.therams.com/audio/les-snead-defensive-changes-ahead-2026-season-talent-from-nfl-combine-player-contracts
Les Snead talks about defensive changes ahead of the 2026 season, talent from the NFL Combine &...
Los Angeles Rams general manager Les Snead talks about potential changes to the defensive secondary this offseason, talented performances at the 2026 NFL...
2026 seasonnfl combinelestalksdefensive
https://www.nfl.com/videos/pelissero-browns-hire-former-falcons-defensive-pass-game-coordinator-mike-rutenberg-as-dc-the-insiders
NFL media insider Tom Pelissero: Cleveland Browns hire former Atlanta Falcons' defensive pass game...
Feb 17, 2026 - NFL media insider Tom Pelissero shares that Cleveland Browns hire former Atlanta Falcons' defensive pass game coordinator Mike Rutenberg as defensive...
media insidertom pelisserocleveland brownsatlanta falconsnfl
https://www.nbcnewyork.com/news/sports/nfl-jets-hire-dolphins-brian-duker-defensive-coordinator/6451301/
Jets hire Brian Duker as defensive coordinator, AP reports – NBC New York
Jan 28, 2026 - The New York Jets are hiring Miami Dolphins assistant coach Brian Duker as their defensive coordinator, a person familiar told the AP Wednesday.
new yorkjetshirebriandefensive
https://www.skysports.com/nfl/news/12118/13518050/maxx-crosby-baltimore-ravens-back-out-of-trade-for-las-vegas-raiders-defensive-end
Maxx Crosby: Baltimore Ravens back out of trade for Las Vegas Raiders defensive end but set to sign...
Mar 12, 2026 - Baltimore Ravens back out of a trade for Raiders star Maxx Crosby after he reportedly failed his medical; Ravens reassessing their options after multiple free...
las vegas raidersmaxx crosbybaltimore ravensout ofback
https://saw.com/domain-brand-protection
Domain Brand Protection & Defensive Registration | SAW.com
$550M+ in domain sales and 10,000+ clients prove it: Saw.com is the domain broker service and marketplace trusted by Tech Startups and Fortune 500 brands...
brand protectiondefensive registrationdomainsaw
https://www.canishoopus.com/minnesota-lynx/61273/wnba-defensive-player-of-the-year-dpoy-alanna-smith-aja-wilson-minnesota-lynx
WNBA News: Alanna Smith Wins WNBA Co-Defensive Player of the Year | Canis Hoopus
Sep 18, 2025 - In a shocking result, the WNBA announced that Alanna Smith and A’ja Wilson are Co-Defensive Players of the Year.
wnba newsalanna smithcanis hoopuswinsco
https://www.ocregister.com/2026/03/10/chargers-agree-to-extension-with-defensive-back-deane-leonard/
Chargers agree to extension with defensive back Deane Leonard – Orange County Register
Mar 10, 2026 - The team also formally announced the signing of fullback Alec Ingold and agreements with offensive linemen Trevor Penning and Cole Strange and tight end...
orange countychargersagreeextensiondefensive
https://www.bengals.com/photos/best-defensive-backs-tight-ends-2026-nfl-combine-photos
Best of Defensive Backs and Tight Ends at the 2026 NFL Combine | PHOTOS
Feb 28, 2026 - View the best photos of the defensive backs and tight ends at the 2026 NFL Combine.
best ofnfl combinedefensivebackstight
https://www.nbcsports.com/nba/news/timberwolves-take-a-2-1-lead-on-the-nuggets-with-a-dominant-defensive-effort-in-a-113-96-game-3-win
Timberwolves take a 2-1 lead on the Nuggets with a dominant defensive effort in a 113-96 Game 3 win...
Apr 24, 2026 - Rudy Gobert followed his inspired Game 2 effort against Nikola Jokic by stifling the three-time MVP again on an ugly 7-for-26 shooting night.
a 2lead ongame 3timberwolvestake
https://www.nfl.com/videos/can-t-miss-play-33-yard-td-chase-young-steals-football-from-cam-ward-s-for-epic-defensive-score
Can't-Miss Play: 33-yard touchdown! New Orleans Saints defensive end Chase Young steals football...
Dec 28, 2025 - New Orleans Saints defensive end Chase Young sacks Tennessee Titans quarterback Cam Ward, stealing the football in the process and runs 33 yards to the end...
new orleans saintsmissplayyardtouchdown
https://www.ms.now/rachel-maddow/watch/maddow-trump-already-defensive-about-economic-data-that-hasn-t-even-been-released-yet-2486336579901
Maddow: Trump already defensive about economic data that hasn't even been released yet
Feb 10, 2026 - Early economic indicators do not bode well ahead of the release of the official economic numbers later this week. The Trump administration has been cagey about...
economic datatrumpalreadydefensiveeven
https://www.chargers.com/video/elijah-molden-media-availability-post-wild-card-2025
Media Availability: Elijah Molden on Defensive Effort and Overcoming Adversity
Jan 13, 2026 - Chargers defensive back Elijah Molden meets with the media following the Wild Card matchup. Molden discusses the defense's performance against the Patriots,...
overcoming adversitymediaavailabilityelijahdefensive
https://www.morganstanley.com/insights/articles/iran-ceasefire-gold-dollar-treasuries
Iran Ceasefire: Do Defensive Assets Still Work? | Morgan Stanley
Explore how the Iran war has rattled stocks and upended traditional expectations about how defensive assets like Treasuries, gold and the dollar behave.
morgan stanleyiranceasefiredefensiveassets
https://www.nfl.com/videos/texans-select-kayden-mcdonald-with-no-36-pick-in-2026-draft
Houston Texans select defensive tackle Kayden McDonald with No. 36 pick in 2026 draft
Apr 24, 2026 - The Houston Texans select Ohio State Buckeyes defensive tackle Kayden McDonald in Round 2 of the 2026 NFL Draft with the No. 36 overall pick (via a trade with...
houston texanskayden mcdonaldselectdefensivetackle
https://www.nfl.com/videos/chiefs-select-peter-woods-with-no-29-pick-in-2026-draft
Kansas City Chiefs select defensive tackle Peter Woods with No. 29 pick in 2026 draft
Apr 24, 2026 - The Kansas City Chiefs select Clemson Tigers defensive tackle Peter Woods in Round 1 of the 2026 NFL Draft with the No. 29 overall pick (via a trade with the...
kansas city chiefspeter woodsselectdefensivetackle
https://www.proofbox.co/en
Defensive Publishing Platform for Prior Art | Proofbox
Publish inventions as verifiable prior art. Proofbox uses trusted timestamps and paywall control to support freedom to operate and prevent unwanted...
prior artdefensivepublishingplatform
https://www.therams.com/video/tim-keenan-iii-alabama-defensive-lineman-draft-call-les-snead
Alabama defensive lineman Tim Keenan III gets the draft call from Los Angeles Rams general manager...
Apr 26, 2026 - Listen in as Alabama DL Tim Keenan III gets the draft call from Los Angeles Rams general manager Les Snead and defensive line coach Giff Smith.
tim keenan iiilos angeles ramsthe draftgeneral manageralabama
https://www.bengals.com/news/2026-nfl-draft-top-prospects-defensive-tackles
2026 NFL Draft Top Defensive Tackle Prospects
Apr 9, 2026 - View expert breakdowns of the top defensive tackle prospects in the 2026 NFL Draft, and watch the Draft April 23-25 on ESPN and NFL Network.
2026 nfl drafttopdefensivetackleprospects
https://www.nfl.com/videos/can-t-miss-play-myles-garrett-s-23rd-sack-of-2025-sets-nfl-s-new-single-season-record
Can't-Miss Play: Cleveland Browns defensive end Myles Garrett's 23rd sack of 2025 sets NFL's new...
Jan 4, 2026 - Cleveland Browns defensive end Myles Garrett explodes into the backfield to sack Cincinnati Bengals quarterback Joe Burrow for his NFL record 23rd sack of the...
cleveland brownsmyles garrettmissplaydefensive
https://www.jsonline.com/story/sports/nfl/packers/dougherty/2026/04/13/defensive-linemen-packers-could-draft-at-no-52-overall-dougherty/89540457007/
Defensive linemen Packers could draft at No. 52 overall | Dougherty
defensivelinemenpackerscoulddraft
https://www.nfl.com/videos/can-t-miss-play-super-bowl-strip-sack-murphy-collects-the-first-turnover-of-the-game-on-teams-5th-sack
Can't-Miss Play: Super Bowl strip-sack! Seattle Seahawks defensive tackle Byron Murphy collects the...
Feb 9, 2026 - Seattle Seahawks linebacker Derick Hall collects Seattles' fifth sack of the game while forcing New England Patriots quarterback Drake Maye to fumble allowing...
super bowlseattle seahawksmissplaystrip
https://www.aol.com/articles/former-nfl-defensive-lineman-josh-003530875.html
Former NFL defensive lineman Josh Mauro dies at 35 - AOL
Apr 29, 2026 - Former NFL defensive lineman Josh Mauro, who played eight seasons for three different teams, has died. The Arizona Cardinals, Las Vegas Raiders and Mauro's...
formernfldefensivejoshmauro
https://www.detroitlions.com/news/lions-draft-defensive-lineman-tyre-west
Detroit Lions draft defensive lineman Tyre West
Apr 25, 2026 - With the 222nd overall pick, the Detroit Lions select defensive lineman Tyre West.
detroit lionsdraftdefensivetyrewest
https://lotnet.com/
Defensive Patent Protection Against Patent Assertion Entities - LOT Network
Apr 9, 2026 - Protect your company from patent assertion entities (PAEs, also known as “patent trolls”) without costly litigation. LOT Network provides defensive patent...
patent protectiondefensiveassertionentitieslot
https://9to5mac.com/2026/04/14/openai-unveils-gpt-5-4-cyber-an-ai-model-for-defensive-cybersecurity/
OpenAI unveils GPT‑5.4‑Cyber, an AI model for defensive cybersecurity - 9to5Mac
Apr 14, 2026 - OpenAI has announced a new AI model called GPT-5.4-Cyber. Similar to Anthropic’s Claude Mythos, this new “cyber-permissive” variant of its...
ai modelopenaidefensivecybersecurity9to5mac
https://www.manager-magazin.de/finanzen/geldanlage/konsumgueter-etfs-warum-sich-das-defensive-investment-lohnen-kann-a-da59221d-9696-4a86-9f79-03099548cd99
Konsumgüter-ETFs: Warum sich das defensive Investment lohnen kann - manager magazin
Feb 20, 2026 - Lieber in Klarspüler und Tiefkühlkost statt in KI und Tech investieren? Der Sektor der Consumer-Staples lief im großen Aktienboom besonders schlecht. 2026...
manager magazinetfswarumsichdas
https://www.chiefs.com/video/top-defensive-plays-of-the-2025-season-kansas-city-chiefs
Top Defensive Plays of the 2025 Season | Kansas City Chiefs
Jan 28, 2026 - Watch the top plays by the Kansas City Chiefs defense from the 2025 NFL season.
kansas city chiefs2025 seasontopdefensiveplays
https://www.ap.org/news-highlights/spotlights/2026/victor-wembanyama-is-a-unanimous-selection-as-the-nbas-defensive-player-of-the-year/
Victor Wembanyama is a unanimous selection as the NBA's defensive player of the year | The...
Apr 22, 2026 - There had never been a unanimous NBA Defensive Player of the Year. Until now. Victor Wembanyama — as expected — was announced Monday as the league's top
victor wembanyamaunanimousselectionnbadefensive
https://www.nfl.com/videos/can-t-miss-play-58-yard-int-return-aidan-hutchinson-off-to-the-races-after-picking-off-stafford
Can't-Miss Play: 58-YARD INT return! Detroit Lions defensive end Aidan Hutchinson off to the races...
Dec 15, 2025 - Detroit Lions defensive end Aidan Hutchinson intercepts the pass from Los Angeles Rams quarterback Matthew Stafford and returns it 58 yards during Week 15 of...
detroit lionsaidan hutchinsonthe racesmissplay
https://chicago.suntimes.com/bears/2026/04/22/bears-gm-ryan-poles-must-put-away-persistent-problems-on-offensive-defensive-lines-in-2026-nfl-draft
Bears GM Ryan Poles must solve persistent problems on offensive, defensive lines in NFL Draft -...
Apr 22, 2026 - For various reasons, some the Bears' fault and some not, the lines of scrimmage still need work heading into Poles' fifth draft Thursday.
nfl draftbearsgmryanpoles
https://www.venn.com/learn/dlp/data-leakage/
Data Leakage in 2025: Types, Causes, and 5 Defensive Measures
Mar 19, 2026 - Data leakage refers to the unauthorized transmission, exposure, or disclosure of sensitive information to an external or untrusted environment.
data leakagein 2025typescausesdefensive
https://www.psu.edu:443/news/altoona/story/altoonas-jack-mckenna-nabs-amcc-defensive-player-week-honors
Altoona’s Jack McKenna nabs AMCC Defensive Player of the Week honors | Penn State University
Apr 7, 2026 - Penn State Altoona men’s volleyball’s outside hitter Jack McKenna, of Manahawkin, New Jersey, was selected the Allegheny Mountain Collegiate Conference’s...
penn state universitythe weekjackmckennadefensive
https://www.securityblue.team/
Security Blue Team: Defensive Cybersecurity Certifications
Security Blue Team is trusted by organizations across the world to provide exceptional defensive cybersecurity training to individuals at all levels.
blue teamsecuritydefensivecertifications
https://www.goldenstateofmind.com/warriors-news/110327/warriors-draymond-green-defensive-player-of-the-year-vote
Warriors Draymond Green earned a Defensive Player of the Year vote | Golden State Of Mind
Apr 21, 2026 - For the 10th time in his career, Warriors forward Draymond Green earned a Defensive Player of the Year Award vote.
draymond greengolden statewarriorsearneddefensive
https://www.nbcnewyork.com/video/nba/victor-wembanyama-2026-nba-defensive-player-of-the-year/6492432/
Victor Wembanyama wins 2026 NBA Defensive Player of the Year award – NBC New York
Apr 20, 2026 - Victor Wembanyama won the 2026 NBA Defensive Player of the Year award unanimously at 22 years old, leading the league in blocks for the second straight season.
victor wembanyamanew yorkwinsnbadefensive
https://www.bengals.com/news/duke-tobin-toasts-defensive-upgrades-before-navigating-next-move-for-nfl-s-highest-spending-team
Quick Hits | Duke Tobin Toasts Defensive Upgrades Before Navigating Next Moves For NFL's Highest...
Apr 27, 2026 - After an exhaustive and expensive offseason rebuild of the Bengals defense centered around the defensive line, director of player personnel Duke Tobin said...
quick hitsduketoastsdefensiveupgrades
https://www.nbcsports.com/watch/nfl/chris-simms-unbuttoned/nfl-draft-2026-defensive-tackle-rankings-christen-miller-georgia
NFL Draft 2026 defensive tackle rankings: Christen Miller, Georgia - NBC Sports
Apr 15, 2026 - Chris Simms and Connor Rogers dive into Christen Miller's background at Georgia, where at a deceiving 321 pounds, possesses a tough play style that could be...
nfl draft 2026christen millernbc sportsdefensivetackle
https://www.aarpdriversafety.org:443/
Online Defensive Driving Course From AARP Driver Safety
The Smart Driver course from AARP is the nation's leading driver safety course. Upon completion, you may qualify for an auto insurance discount.
defensive drivingdriver safetyonlinecourseaarp
https://www.livescience.com/archaeology/romans/hadrians-wall-the-defensive-roman-wall-that-protected-the-frontier-in-britain-for-300-years
Hadrian's Wall: The defensive Roman wall that protected the frontier in Britain for 300 years |...
Aug 4, 2025 - The wall is the largest Roman archaeological feature in Britain and was built to defend the northernmost limit of the Roman Empire.
walldefensiveromanprotectedfrontier
https://www.sun-sentinel.com/2025/12/25/broward-4a-1a-football-defensive-player-of-the-year/
Broward 4A-1A football defensive player of the year: Terrance Johnson, American Heritage senior;...
Dec 26, 2025 - Johnson led the county with 12 interceptions, and Junius piled up 102 tackles, 16 for a loss and two forced fumbles.
american heritagebroward4a1afootball
https://www.jaguars.com/photos/k000588-jaguars-best-of-2025-defense-highlights
Jaguars Best of 2025: Defensive Highlights
Feb 11, 2026 - Relive the top defensive moments of the 2025 season and the plays that defined the Jaguars defense.
best of 2025jaguarsdefensivehighlights
https://www.chicagotribune.com/2026/04/17/us-world-cup-outlook/
Can US men earn 1st knockout win in World Cup since 2002? There are goalkeeping and defensive...
Apr 17, 2026 - The United States heads into the World Cup hoping for its first knockout-stage victory since 2002.
world cupusmenearn1st
https://www.dallascowboys.com/news/defensive-minded-cowboys-finalize-2026-nfl-draft-class
Defensive-minded Cowboys finalize 2026 NFL Draft class
Apr 25, 2026 - The Cowboys' 2026 NFL Draft class is complete, as the Cowboys added seven players, including five on defense, headlined by first-round pick Caleb Downs.
2026 nfl draftdefensivecowboysclass
https://defensivecss.dev/
Defensive CSS
Practical CSS and design tips that helps in building future-proof user interfaces.
defensive css
https://www.ocregister.com/2026/04/21/chargers-nfl-draft-preview-edge-rusher-is-top-defensive-priority/
Chargers NFL draft preview: Edge rusher is top defensive priority – Orange County Register
Apr 21, 2026 - Beyond Khalil Mack and Tuli Tuipulotu, the team lacks depth at the position after losing Odafe Oweh in free agency, and GM Joe Hortiz has suggested the draft...
nfl draftorange countychargerspreviewedge
https://www.uc.edu/about/admin-finance/ehs/training/defensive-driving-training.html
Defensive Driving Training - About the University of Cincinnati | A Top Public Research and Co-op...
defensive driving trainingabout the universitypublic researchcincinnatitop
https://www.houstontexans.com/video/demeco-ryans-on-c-j-stroud-colts-weapons-and-texans-defensive-standard-full-week-13-presser
DeMeco Ryans On C.J. Stroud, Colts Weapons And Texans Defensive Standard | Full Week 13 Presser
Nov 28, 2025 - Texans Head Coach DeMeco Ryans talks to the media ahead of the team's Week 13 matchup with the Colts.
week 13stroudcoltsweaponstexans
https://www.raiders.com/audio/trevor-sikkema-2026-nfl-draft-updates-names-to-watch
Trevor Sikkema likes the value of defensive tackle in the 2026 NFL Draft | RPN
Trevor Sikkema breaks down the top quarterback prospects in the 2026 NFL Draft and shares names to know for the Raiders.
2026 nfl draftthe valuetrevorlikesdefensive
https://news.cgtn.com/news/2026-04-23/Expert-Japan-s-defensive-shift-raises-alarms-in-the-region--1MA9sEBeAGA/p.html
Expert: Japan's 'defensive' shift raises alarms in the region - CGTN
Apr 23, 2026 - Professor Anna Rosario Malindog-Uy, a Philippine geopolitical expert, highlights a troubling shift in Japan's defense posture, saying that Japan's missile...
in the regionexpertjapandefensiveshift
https://www.sun-sentinel.com/2025/12/25/broward-7a-5a-football-defensive-player-of-the-year/
Broward 7A-5A football defensive player of the year: Jermiyah Douglas, St. Thomas Aquinas senior –...
Dec 26, 2025 - Douglas had four interceptions, a fumble recovery, 11 PBUs, 38 solo tackles, a sack and three other tackles for loss.
st thomasbroward7a5afootball
https://www.drivesafeonline.org/
Defensive Driving Courses & Traffic School | DriveSafe Online®
Apr 6, 2026 - DriveSafe Online defensive driving courses and traffic school can save you up to 10% on car insurance, reduce points on your license, or get your ticket...
defensive drivingtraffic schoolcourses
https://sports.yahoo.com/articles/timberwolves-2-1-lead-nuggets-043854422.html
Timberwolves take a 2-1 lead on the Nuggets with a dominant defensive effort in a 113-96 Game 3 win...
Apr 24, 2026 - Rudy Gobert followed his inspired Game 2 effort against Nikola Jokic by stifling the three-time MVP again on an ugly 7-for-26 shooting night.
a 2lead ongame 3timberwolvestake
https://chicago.suntimes.com/high-school-football/2026/04/05/safety-darrell-mattison-keeps-up-morgan-parks-tradition-of-talented-defensive-backs-wide-receivers
Safety Darrell Mattison keeps up Morgan Park’s tradition of talented defensive backs, wide...
Apr 5, 2026 - Mattison, a consensus four-star prospect who recently committed to Michigan in the 2027 recruiting cycle, follows in the footsteps of Nasir Rankin, Tysean...
safetydarrellkeepsmorgantradition
https://www.getdefensive.com/
Online Texas Defensive Driving School | GetDefensive
Texas-approved online defensive driving and ticket dismissal courses. Learn at your pace and get your certificate fast with GetDefensive.
defensive drivingonlinetexasschool
https://www.nfl.com/videos/hof-db-rod-woodson-wakes-up-with-gmfb-and-discusses-pittsburgh-hosting-2026-nfl-draft
Hall of Fame defensive back Rod Woodson wakes up with 'GMFB' and discusses Pittsburgh hosting 2026...
Apr 24, 2026 - Hall of Fame defensive back Rod Woodson wakes up with
hall of famedefensivebackrodwakes
https://www.latimes.com/sports/story/2026-03-30/joey-browner-usc-vikings-buccaneers
Joey Browner death: He was a star defensive back for USC and Vikings - Los Angeles Times
Mar 31, 2026 - Joey Browner, a defensive back who was named USC's team MVP in 1982, has died at age 65. He was an inductee to the Minnesota Vikings' Ring of Honor and named...
los angeles timesjoeydeathstardefensive
https://www.dallascowboys.com/news/cowboys-confident-in-new-defensive-additions-we-ve-changed-this-defense
Cowboys confident in new defensive additions: 'We've changed this defense'
Apr 25, 2026 - Through two days of the NFL Draft, the Cowboys have drafted three new defenders and traded for another to add to Christian Parker's defense. Dallas is...
cowboysconfidentnewdefensiveadditions
https://www.tampabay.com/sports/bucs/2026/04/03/rakeem-nunez-roches-new-york-giants-defensive-depth/
Bucs welcome back defensive lineman Rakeem Nunez-Roches
Apr 4, 2026 - After spending the last three years with the Giants, he rejoins Tampa Bay on a one-year deal.
welcome backbucsdefensive
https://www.nbcnewyork.com/nba/spurs-victor-wembanyama-wins-defensive-player-of-the-year/6492165/
Spurs star Victor Wembanyama wins Defensive Player of the Year – NBC New York
Apr 20, 2026 - At just 22 years old, Spurs star Victor Wembanyama is the youngest player to ever win Defensive Player of the Year – and he did it unanimously.
victor wembanyamanew yorkspursstarwins
https://www.safemotorist.com/
Online Traffic School and Defensive Driving Courses | SafeMotorist
SafeMotorist is your #1 online source for state-approved defensive driving training, drivers ed, insurance discounts and boater safety courses.
traffic schooldefensive drivingonlinecourses
https://www.colts.com/news/caden-curry-center-grove-greenwood-indiana-ohio-state-defensive-end-sixth-round-2026-nfl-draft
Colts select Ohio State defensive end Caden Curry in sixth round of 2026 NFL Draft
Apr 26, 2026 - Curry, a Center Grove alum, led Ohio State in sacks and tackles for a loss in 2025.
2026 nfl draftohio statecaden currycoltsselect
https://www.nfl.com/videos/rapoport-raiders-trade-tyree-wilson-to-saints-in-exchange-for-round-5-pick-in-2026-nfl-draft
NFL Network Insider Ian Rapoport: Las Vegas Raiders trade defensive end Tyree Wilson to New Orleans...
Apr 28, 2026 - NFL Network Insider Ian Rapoport reports that the Raiders have traded defensive end Tyree Wilson to the New Orleans Saints.
las vegas raidersnfl networkian rapoporttyree wilsonnew orleans
https://www.detroitlions.com/news/a-closer-look-defensive-lineman-tyre-west-2026-nfl-draft-detroit-lions
A CLOSER LOOK: Detroit Lions defensive lineman Tyre West
Apr 25, 2026 - Tim Twentyman takes a closer look at the Detroit Lions’ seventh-round selection of defensive lineman Tyre West.
a closer lookdetroit lionsdefensivetyrewest
https://www.therams.com/news/tim-keenan-iii-defensive-lineman-rams-defensive-front-ty-simpson-nfl-draft
Wait was worth it for defensive lineman Tim Keenan III, pick 232 in 2026 NFL Draft, in joining Rams...
Apr 26, 2026 - New Rams defensive lineman Tim Keenan III reacts to getting selected by the team in the seventh round of the 2026 NFL Draft.
tim keenan iii2026 nfl draftworth itwaitdefensive
https://www.jalopnik.com/2144266/defensive-driving-course-education-and-car-insurance-savings/
What Will You Learn At A Defensive Driving Course (That Could Also Save Money On Your Insurance)?
Apr 16, 2026 - Defensive-driving trainers teach techniques like
defensive drivingsave moneylearncoursecould
https://www.accessgrantedtrafficschool.com/
Access Granted Traffic School | Defensive Driving Course
traffic schooldefensive drivingaccessgrantedcourse
https://nypost.com/2026/04/24/betting/david-bailey-opens-as-favorite-for-defensive-rookie-of-the-year/
Jets' David Bailey opens as favorite for Defensive Rookie of the Year
After the first round of the 2026 NFL Draft, the Jets
david baileyjetsopensfavoritedefensive
https://www.azcardinals.com/podcasts/big-red-rage-cardinals-draft-countdown-mike-lafleur-s-culture-and-defensive-rebound
Big Red Rage - Cardinals Draft Countdown, Mike LaFleur’s Culture And Defensive Rebound
Ep. 763 - With the NFL Draft two weeks away, Paul Calvisi and Ron Wolfley break down the latest mock draft buzz surrounding the Arizona Cardinals and GM Monti...
big redragecardinalsdraftcountdown
https://www.nfl.com/videos/cowboys-introduce-christian-parker-as-new-dc-the-insiders
Dallas Cowboys introduce Christian Parker as new Defensive coordinator | 'The Insiders'
Feb 19, 2026 - The Dallas Cowboys have hired Christian Parker as their new defensive coordinator.
dallas cowboysthe insidersintroducechristianparker
https://www.nbcsports.com/college-football/news/indiana-defensive-coordinator-responds-to-comments-from-ex-alabama-qb-ty-simpson-over-rose-bowl-loss
Indiana defensive coordinator responds to comments from ex-Alabama QB Ty Simpson over Rose Bowl...
Apr 20, 2026 - Indiana defensive coordinator Bryant Haines heard the comments from former Alabama quarterback Ty Simpson about the teams’ matchup last season in the Rose Bowl...
ty simpsonrose bowlindianadefensivecoordinator
https://www.nydailynews.com/2026/04/22/ohio-state-safety-caleb-downs-could-be-next-giants-defensive-leader/
Ohio State safety Caleb Downs could be next Giants defensive leader
Apr 22, 2026 - This is an exciting time as John Harbaugh sets the tone for what a new day in New York will look like.
ohio statecaleb downssafetycouldnext
https://opendorse.com/profile/242ufifod
Jorge Gonzalez, Defensive Line, Caldwell University - NIL Profile - Opendorse
Jorge Gonzalez's Opendorse Profile. Deal marketplace for autographs, shoutouts, social posts and more. Support your favorite athlete today.
jorgegonzalezdefensivelinecaldwell
https://www.sbnation.com/mlb/1109632/jo-adell-turned-in-the-best-defensive-game-in-mlb-history
Jo Adell turned in the best defensive game in MLB history | SB Nation
Apr 5, 2026 - Angels outfielder Jo Adell turned in one of the best defensive performances you will ever see
in thesb nationjoadellturned
https://uhcougars.com/news/2026/4/18/womens-basketball-womens-basketball-lands-all-wac-defensive-and-freshman-team-honoree-elodie-lutbert
Women’s Basketball Lands All-WAC Defensive and Freshman Team Honoree Elodie Lutbert - University of...
Center Elodie Lutbert, an All-WAC Freshman and Defensive Team honoree, has signed with the University of Houston Women's Basketball program, Head Coach Matth...
basketballlandswacdefensivefreshman
https://www.azcardinals.com/news/cardinals-select-defensive-lineman-kaleb-proctor-in-fourth-round
Cardinals Select Defensive Lineman Kaleb Proctor In Fourth Round
Apr 27, 2026 - Add to depth with Southland Player of the Year
kaleb proctorcardinalsselectdefensivefourth