https://jpswebdesigns.com/
Web Design Services & Digital Marketing Fresno, CA - JP Solutions
web design servicesdigital marketingfresno cajpsolutions
https://zeno.design/
Web Design Services & Digital Experiences | Zeno Design
web design servicesdigital experienceszeno
https://sophonstrategies.com/
Sophon Strategies | Web Design Services & Digital Marketing
Nov 24, 2025 - Web design services and digital marketing built for small and mid-sized businesses.
web design servicessophonstrategiesdigitalmarketing
https://amplified.cc/
Amplified Graphic Design Services | digital & print marketing, website creation, e commerce...
graphic design servicesdigital printamplifiedmarketingcreation
https://gmdesignservices.com/
Gary Meleski Design Services - Digital Architectural Design
design services digitalgaryarchitectural
https://bluecarrotcreative.com/
Frisco SEO & Web Design Services | Digital Online Marketing Company
Jun 26, 2024 - Blue Carrot Creative | Providing digital marketing strategy review in Frisco and Plano Texas through web design written search optimized, search engine...
seo web designdigital online marketingfriscoservicescompany
https://www.excitebrand.com/
Web Design Services | Digital Marketing Services | Excitebrand
Want to generate more business online? Excitebrand is providing the best and most creative web design and digital marketing services. Get a quote now.
web design servicesdigital marketing
https://getwebcanvas.com/ai-web-design/
AI Web Design Services - Digital Solutions for Web, SEO & AI Growth. Pittsburgh based.
ai web designservices digitalseo growthsolutionspittsburgh
https://www.emccdesign.com/
Fort Myers Web Design Services | Digital Marketing, Web Development Cape Coral | EMCC Design
Mar 30, 2026 - We specialize in custom web design and responsive web development for businesses in Fort Myers and Cape Coral. Our mobile-friendly websites will help you stand...
fort myers webdesign services digitalmarketing developmentcape coralemcc
https://aelieve.com/services/creative-design
Creative Design Services | Creative Digital Marketing | Aelieve
Are you looking for creative website experts? Aelieve Digital Marketing offers web design, video production, logo design, and more. Find out more about our...
creative design servicesdigital marketingaelieve
https://www.gozoek.com/
Zoek: #1 Wix Digital Marketing Agency, SEO, Web Design & Development Services - Zoek Marketing
Zoek is the #1 growth marketing agency offering small business website design, SEO, social media marketing, online marketing tools, and white label services....
digital marketing agencyseo web designzoekwixdevelopment
https://gaugedigitalmedia.com/
#1 Digital Marketing For Home Services | SEO, PPC, Web Design
Apr 17, 2026 - Grow your home service company with Gauge Digital. Stop buying shared leads. Have us build your exclusive lead machine. Contact us today!
services seo ppcdigital marketingwebdesign
https://thirteen05.com/
Web Design and Digital Marketing Services - thirteen05 creative
Jan 28, 2026 - thirteen05 creative is a full-service web design and digital marketing agency that builds world-class websites and delivers SEO results.
digital marketing servicesweb designcreative
https://thevisiontech.com/
Website Design And Development Services | Digital Advertising Agency
Thevisiontech offers cutting-edge website design, development, and innovative advertising and marketing services to help your brand grow. Schedule a free...
development services digitaldesignadvertisingagency
https://www.piiperdigitalsolutions.com/
Piiper Digital Solutions | Home | Web Design & SEO Services
Piiper specializes in keeping our clients ahead of the competition through Increased Visibility, improved SEO Strategies, and executive Web Design services.
web design seodigital solutionsservices
https://www.genpact.com/services/experience
Digital Experience Design Services | Genpact
Genpact helps you design digital experiences that anticipate needs, connect systems, and turn technology into real adoption and business value.
digital experience designservicesgenpact
https://mountaintopwebdesign.com/
Digital Marketing, SEO & Website Design Services
We offers web design and digital marketing services. We create high performing websites and marketing strategies that generate more leads to turn them into...
digital marketing seodesignservices
https://infostreamusa.com/
Web Design & Digital Marketing Services | InfoStream Solutions
Jul 10, 2024 - InfoStream Solutions is a web design and digital marketing company that helps companies and organizations develop and enhance their online brands.
web design digitalmarketing servicesinfostreamsolutions
https://oscwebdesign.biz/
Custom Web Design, Development & Digital Marketing Services: Maine Web Design & Marketing | OSC Web...
Feb 17, 2025 - Are you ready to take your business to the next level? Good, because that's what we're here to help you do. Using our digital design and marketing expertise,...
custom web designdevelopment digital marketingservicesmaineosc
https://www.tenpine.ca/
Niagara Web Design and Digital Marketing Services | Tenpine
Need a website? We are a leading Niagara web design company offering digital marketing, hosting, domain registration, SEO, logo design and more.
digital marketing servicesweb designniagara
https://www.allianceinteractive.com/
Web Design, Digital Marketing Agency & Website Maintenance Services
web design digitalmarketing agencymaintenanceservices
https://rangehomeservices.com/
Digital Marketing Agency, Local SEO Services, Website Design & Search Engine Optimization | | Range...
digital marketing agencylocal seo servicesdesign search engineoptimizationrange
https://fiveriversmarketing.com/
Digital Marketing Services in Dayton & Cincinnati, Ohio - Five Rivers Marketing, Website Design &...
Mar 11, 2026 - Empowering businesses with data-driven website design and SEO for enhanced engagement and growth. Discover the Five Rivers Marketing difference.
digital marketing servicesdayton cincinnatifive riversohiodesign
https://www.envisionup.com/
Digital Marketing Agency Canada - SEO, Web Design, PPC Services
Jan 29, 2026 - Save time and Money. Experts in Home Services Marketing, B2B Services and Charities and Associations. Certified Google Partner.
digital marketing agencyseo web designcanadappcservices
https://www.csdesignstudios.com/
Tucson Digital Marketing Agency - Web Design and SEO Services
Jun 26, 2025 - CS Design Studios is the trusted digital marketing company delivering exceptional SEO, Web Design and Social Media in Tucson. Call 520-908-6088.
digital marketing agencyweb designtucsonseoservices
https://wheelhorsedigital.com/
Wheel Horse Digital | Springfield MA Web Design, SEO & Digital Marketing Services
Website design, SEO and sales funnel/email marketing services for small local businesses in Western Massachusetts
web design seohorse digitalwheelspringfieldmarketing
https://www.thedesignhitman.com/
Ignite Your Brand đź’Ą Expert Digital Marketing Services đź’Ą The Design Hitman
Transform your brand with Patrick Scully's 29 years of digital design and marketing expertise. Discover compelling strategies for agencies, web design firms,...
expert digital marketingignitebrandservicesdesign
https://www.tseg.com/
Law Firm Digital Marketing | Legal Web Design Services
May 6, 2026 - Let TSEG run your Law Firm's digital marketing campaign. We offer web design, SEO and PPC services for law firms nationwide. Contact us to get started!
law firm digitalmarketing legalweb designservices
https://theevolvingdigital.com/
Expert Digital Marketing & Design Services | The Evolving Digital
Mar 19, 2026 - Enhance your online presence with web design, SEO, branding, and more from The Evolving Digital. Let’s build your brand today!
expert digital marketingdesign servicesevolving
https://thumplocal.com/
Local Online Digital Advertising & Internet Marketing Services Agency, Website Design & Development...
Dec 16, 2024 - At Thump Local, we understand that the process of establishing a superior web presence needs to be straightforward. We believe your experience with us will be...
internet marketing serviceslocal onlinedigital advertisingagencydesign
https://samanthadigital.com/
Web Design & SEO Services for Small Business | Samantha Digital
Jan 31, 2026 - Looking for a digital marketing agency in Virginia, Northern VA, Washington DC, or Maryland? Look no further than Samantha Digital LLC for...
web design seosmall businessservicessamanthadigital
https://www.bluetonemedia.com/
Local Web Design & Digital Marketing Agency | Expert SEO Services | Wilmington NC - BlueTone Media...
BlueTone Media offers expert web design and internet marketing services in Wilmington NC. Our solutions include SEO, PPC, custom WordPress designs, and more....
local web designdigital marketing agencyexpert seo serviceswilmingtonbluetone
https://ioweb.my/
Web Design, Digital Marketing Services - Innovative Web Solutions for Businesses in Malaysia
Jun 20, 2025 - IOWEB.my offers cutting-edge web design, development, and digital solutions tailored for Malaysian businesses. Empower your online presence with professional...
web design digitalmarketing servicesinnovative solutionsbusinessesmalaysia
https://www.tdtrg.com/
Web Design, Development and Digital Marketing Services in NY
May 15, 2026 - Digi Tech Resources Group: Your Partner in Custom Websites, Mobile Apps, Digital Marketing, SEO, PPC, and Social Media Optimization Services.
web design developmentdigital marketing servicesny
https://www.rumahmedia.com/
RUMAH MEDIA: Web Design Bali | Digital Agency | SEO Services
We are Bali web developer, web design, SEO services, digital marketing agency, online course, mobile developer that will help create value for your business.
media web designdigital agency seorumahbaliservices
https://www.studiotreble.com/
Studio Treble | Design, digital & motion services in Manchester
Working with clients across arts, culture and technology, we create digital solutions to human problems.
design digitalstudiotreblemotionservices
https://wiredmustang.com/
Full-Service Digital Marketing Agency, Search Engine Optimization & Website Design Services...
Apr 28, 2026 - Wired Mustang is your go-to digital marketing agency in Colorado. Specializing in SEO, PPC AdWords, reputation management, web design, and social media...
full service digitalmarketing agency searchengine optimizationdesignservices
https://www.elevateom.com/
UK Digital Marketing Services & Web Design | ElevateOM
uk digital marketingservices web design
https://p8dmc.com/
Top Digital Marketing Agency in Bucks County PA, Web Design, SEO, PPC Services - Planet 8 Digital
top digital marketingbucks county paweb design seoppc servicesagency
https://www.lmgnow.com/
Website Design Company, SEO Services, Digital Marketing | Phoenix AZ
Aug 19, 2025 - Lifestyles Media Group is a professional Phoenix-based website design company also providing search engine optimization and digital marketing services.
design company seoservices digital marketingphoenixaz
https://www.justintimellc.net/
Just-in-Time Digital Marketing | Web Design & Digital Marketing Services in Connecticut
Grow your business with Just-in-Time Digital Marketing. We specialize in web design, SEO, branding, and digital marketing services tailored for small...
digital marketing webdesign servicestimeconnecticut
https://www.ssftech.co.uk/
Professional Web, Design & IT Services UK | Your Digital Growth Partner
professional web designservices ukdigital growthpartner
https://elevaedigital.com/
Strategic Website Design Services | Élevae Digital
Jan 22, 2026 - Elevate your brand with expert website design, SEO, and digital marketing from Élevae Digital. We turn strategy into stunning, high-performing websites.
design servicesstrategicdigital
https://www.pixelarmy.ca/
Edmonton Web Design and Digital Marketing Services| Pixel Army
Edmonton Web Design, SEO and Digital Marketing services. Over 20 Years of high-performing responsive websites.
edmonton web designdigital marketing servicespixelarmy
https://socialhunt.net/
Digital Marketing Agency | SEO Services Company | PPC Expert Services | Custom Logo Design |...
Apr 1, 2026 - Partner with our full-service digital marketing agency and SEO services company. We offer PPC expert services, custom logo design, and website development to...
digital marketing agencyseo services companyexpert customppclogo
https://designstudioonline.com/
HOME - DESIGN STUDIO ONLINE #1 Digital Design Services | Digital Design Company in USA
Dec 16, 2025 - Design Studio is a Digital Design Agency offering Creative Web Solutions at Affordable Rates. We Provide the Best Digital Design Services in the United States.
design studiodigital servicesonlinecompanyusa
https://www.agencyjet.com/
Digital Marketing Agency: Affordable SEO, PPC & Web Design and Development Services | Agency Jet
Agency Jet is a full-service digital marketing agency with 6 offices nationwide. We provide expert online marketing services including SEO, pay per click, and...
digital marketing agencyseo ppc webdevelopment servicesaffordabledesign
https://canberrafc.com/
Digital Agency Services – Web Design, Development & Marketing | Canberrafc
Professional digital agency services by Canberrafc. We offer web design, development, branding and PPC marketing to help your business grow and succeed online.
digital agency servicesweb design developmentmarketing
https://www.marswebsolution.com/
Web Design & Digital Marketing Services | Mars Web Solution
Boost your online presence with Mars Web Solution! Expert web design and SEO services to enhance your business. Let's conquer the digital realm together. 🚀
web design digitalmarketing servicesmarssolution
https://voilamediagroup.com/
Voila Media Group | Digital Marketing Solutions and Web Design Services
Mar 9, 2026 - Voila Media Group is a leading provider of digital marketing solutions and web design services. We help businesses establish a strong online presence, drive...
media group digitalmarketing solutionsweb designvoilaservices
https://www.penpublishing.com/
Website Design | Hosting Services | Digital Marketing - Wichita
Local Wichita web experts since 1994, Pen Publishing Interactive delivers website design, hosting, business email and digital marketing that drive growth.
design hosting servicesdigital marketingwichita
https://immensotech.com/
UI / UX, CMS Website Design & App Development Services, SEO Digital Marketing Company | Immenso Tech
design app developmentservices seo digitalui uxmarketing companycms
https://risevisible.com/
Leaders In Web Design | SEO | Digital Marketing Services | Rise Visible
Feb 12, 2026 - Rise Visible is a Boise-based web design, SEO, and marketing agency with 27+ years of experience helping businesses grow online.
web design seodigital marketing servicesleadersrisevisible
https://salterrasite.com/
Salterra Digital Services, SEO and Web Design
Salterra Digital Services delivers WordPress web design, SEO, and growth services for medical and home service businesses nationwide. Book an audit.
digital services seowebdesign
https://www.enetwebservices.com/
Web Design, SEO and Digital Marketing Company - eNet Web Services
web design seodigital marketing companyenetservices
https://jpdcreativestudio.com/
JPD Creative Studio » Custom design and digital services
creative studiocustom designjpddigitalservices
https://ciniva.com/
Virginia Digital Marketing Agency, Website Design Services
digital marketing agencyvirginiadesignservices
https://www.sproutmedialab.com/
Digital Marketing Agency Raleigh, Orlando, Daytona | SEO Company & Web Design Services Raleigh NC
digital marketing agencyseo company webdesign servicesraleighorlando
https://dfwwebsiteseo.com/
Dallas Digital Marketing Agency: SEO, PPC & Web Design Services
dallas digital marketingagency seo ppcweb designservices
https://www.sleekinfosolutions.com/
Website design company|Digital marketing services Company India,USA,UK
We are website design, development company in India providing PHP,mobile apps development,digital marketing SEO service,Android app development, ecommerce...
design company digitalmarketing services indiausauk
https://onecallwebdesign.com/
One-Call Web Design & Digital Marketing Services
web design digitalone callmarketingservices
https://www.qeretail.com/
eCommerce Digital Agency | Design, Market & Manage Services - QeRetail
ecommerce digital agencydesign marketmanageservices
https://allegracmg.com/
Website Design & Digital Marketing Services | CMG
Oct 2, 2025 - A team of digital marketing experts, Creative Marketing Group offers high-quality website design, marketing automation, and SEO services.
design digital marketingservicescmg
https://technicalyatra.com/
Best Website Design | SEO | Digital Marketing | IT Services
design seo digitalbestmarketingservices
https://www.the-web-guys.com/
The Web Guys | Digital Marketing & Website Design Services
Mar 2, 2026 - The Web Guys is a service-driven digital marketing firm in Carmel, IN. Call us at (317) 805-4933 to learn more.
digital marketingwebguysdesignservices
https://orqadesign.com/
Web Design & Development, HTML Email, Graphic Design, Digital Design & Branding Services in Malvern...
Orqa Design provides creative design and web services from Malvern, Worcestershire, working with clients locally and around the world. They specialise in...
web design developmenthtml emailgraphic digitalbranding servicesmalvern
https://10design.gr/
Web design & Digital Services by 10 DESIGN - Anargyros Dekavallas
web design digitalservices
https://jsmtmedia.com/
JSMT Media | Custom Web Design & Digital Marketing Services
custom web designdigital marketingmediaservices
https://www.kitemedia.com/
Kite Media Digital Marketing & Web Design Services in Logan, Utah
media digital marketingweb design serviceskiteloganutah
https://www.digitalstormmarketing.com/
Website Design and Web Services - Digital Storm Marketing
web services digitaldesignstormmarketing
https://midascreative.co.uk/
Website Design Mansfield | SEO Services & Digital Marketing
seo services digitaldesign mansfieldmarketing
https://www.waterscapetech.com/
SMART Web Design & Digital Marketing Services-WaterscapeTech
smart web designdigital marketing services
https://clearcutdigital.com/
New Hampshire Web Designer | Web Design Services | Manchester, NH | Clear Cut Digital
new hampshireweb designerservices manchesterclear cutnh
https://www.kyberdigital.co.uk/services
Web Design & Digital Marketing Agency Northern Ireland | Kyber Digital | Our Services
We are the go-to digital agency for delivering complex technical strategiesYou dont need to change your business to match our technology
web design digitalmarketing agency northernirelandkyberservices
https://aknetworksolutions.com/online-reputation-management-services-orm/
Online Reputation Management Services (ORM) | Web Design & Development, Digital Marketing & Data...
online reputation managementweb design developmentdigital marketingservicesorm
https://gaitandesign.us/
GRAPHIC DESIGN DIGITAL MARKETING STUDIO SERVICES - Gaitandesignus
May 7, 2024 - Graphic design and creative advertising in Miami / Aventura.
graphic design digitalmarketing studioservices
https://helium-seo.com/web-design-digital-marketing-agency/
Web Design Digital Marketing Agency - SEO Services - Helium SEO
Nov 11, 2025 - Say goodbye to complex marketing jargon and hello to straightforward, effective marketing that fills your calendar with Web design jobs. Helium isn’t a vendor....
web design digitalmarketing agency seoserviceshelium
https://distrakt.ca/
Website Design & Digital Marketing Services | Distrakt Media
Mar 21, 2026 - Distrakt helps businesses grow with modern website design, SEO, social media marketing, and industry strategy. Custom websites built to generate leads.
design digital marketingservicesmedia
https://aknetworksolutions.com/best-bing-ppc-services-a-complete-guide/
Best Bing PPC Services: A Complete Guide for 2025 - Web Design & Development, Digital Marketing &...
Aug 2, 2025 - Best Bing PPC Services: A Complete Guide for 2025 While Google Ads dominates the PPC landscape, Bing PPC services—powered by Microsoft Advertising—offer unique...
web design developmentbing ppccomplete guidebestservices
https://www.martinthiemann.de/
Martin Thiemann – I design digital products and services.
design digitalmartinthiemannproductsservices
https://xlncdigital.com/services/
Services | Brand Identity, Web Design, Digital Marketing & App Development
We specialize in web design, digital marketing, branding, and content creation, with a passion for helping small businesses grow through transparency and...
brand identity webdesign digital marketingservicesappdevelopment
https://davezdesignz.com/
Web Design, SEO, & Digital Marketing | David Downey Professional Services
Apr 29, 2026 - Professional web design, development, SEO, and digital marketing by David Downey. Over 30 years of experience delivering fast, custom, and results-driven...
web design seodigital marketingdaviddowneyprofessional
https://www.indigodigitaal.com/graphic-design/
Graphic Design Services | Indigo Digitaal | Digital Marketing
Mar 9, 2022 - Indigo Digitaal provides graphic design, logo design and branding services, including print design. We make you look good.
graphic design servicesindigodigitaaldigitalmarketing
https://algotechnology.us/
Algo Technology - Web Design & Digital Marketing Services in USA
technology web designdigital marketing servicesalgousa
https://decorasoft.com/
Decora Soft - Website Design & Website Development Services | SEO | Digital Marketing
Sep 20, 2023 - Decora Soft offers best website design and development services for all countries. Call us on +918591213003 to design or develop any type of website.
design development servicesseo digitaldecorasoftmarketing
https://etechnocraft.com/
Digital Marketing Agency SEO Services, PPC, Web Design, Web Development | eTechnoCraft Internet...
digital marketing agencyseo services ppcweb design developmentinternet