Robuta

https://classdismissed.us/ Class Dismissed Class Dismissed - AR Experience class dismissed https://www.hivjustice.net/cases/us-charges-of-alleged-hiv-non-disclosure-dismissed-for-the-second-time-in-michigan-against-undetectable-transgender-woman/ US: Charges of alleged HIV non-disclosure dismissed for the second time in Michigan against... The HIV Justice Network (HJN) is the leading community-based NGO building a co-ordinated, effective global response to punitive laws and policies that impact... for the secondtime inuschargesalleged https://www.wklaw.com/question/i-was-arrested-for-dui-this-past-weekend-but-the-officer-never-read-me-my-miranda-rights-can-i-get-the-case-thrown-out/ No Miranda Rights: Can DUI Case Be Dismissed? Dec 5, 2024 - Arrested for DUI without being read your Miranda rights? Discover when this can impact your case and explore potential defense options. miranda rightsduicasedismissed https://nahoumlaw.com/us-equities-judgment-voluntarily-vacated-lawsuit-dismissed-two-2-states-due-sewer-service/ US Equities Judgment Voluntarily Vacated and Lawsuit Dismissed in Two 2 States Due to Sewer Service... Dec 14, 2023 - Our client discovered that 2 default judgments were entered against him in NY and Ct. by junk debt buyer U.S. Equities Corp. for more that $14,000.00. sewer serviceusequitiesjudgmentvacated https://allmandlaw.com/texas-bankruptcy-faqs/my-bankruptcy-case-was-dismissed-what-do-i-do-now/ My Bankruptcy Case Was Dismissed, What Do I Do Now? - Allmand Law Firm, PLLC law firmbankruptcycasedismissedallmand https://www.carcomplaints.com/news/2026/chrysler-300-dodge-charger-door-panel-warp-lawsuit-dismissed.shtml Chrysler 300, Dodge Charger Door Panel Warp Lawsuit Dismissed | CarComplaints.com A Chrysler 300 and Dodge Charger warped door panel class action lawsuit has been dismissed after years in court. The original warped panel class action lawsuit... dodge chargerdoor panelchryslerwarplawsuit https://www.classaction.org/news/nfl-team-websites-illegally-shared-subscriber-data-with-facebook-class-action-claims NFL Team Websites Illegally Shared Subscriber Data with Facebook, Class Action Claims [DISMISSED] Oct 5, 2023 - A class action alleges the websites for each NFL team have unlawfully shared the personal identifying information of newsletter subscribers with Facebook... class action claimsnfl teamwebsitesillegallyshared https://www.dabangasudan.org/en/all-news/article/journalists-detained-and-dismissed-in-sudan Journalists detained and dismissed in Sudan - Dabanga Radio TV Online Jun 20, 2019 - Two Sudanese journalists were detained on Monday. The editor-in-chief of El Sayha newspaper was dismissed. Many journalists at the official media channels were... tv onlinejournalistsdetaineddismissedsudan https://townofnorway.org/5-reasons-microsoft-dismissed-world-of-warcraft-on-game-pass/ 5 Reasons Microsoft Dismissed World Of Warcraft On Game Pass - Townofnorway Oct 11, 2025 - Microsoft has recently addressed the ongoing speculation surrounding the availability of World of Warcraft on its Xbox Game Pass service. With the gaming world of warcraftgame passreasonsmicrosoftdismissed https://bfsi.economictimes.indiatimes.com/news/fintech/pils-against-operations-of-google-pay-dismissed-by-hc/102885658 PILs against operations of Google Pay dismissed by HC, ETBFSI Dismissing the petitions, a bench headed by Chief Justice Satish Chandra Sharma said Google Pay is "mere third-party app provider" which requires no... google paypilsoperationsdismissedhc https://www.wlrn.org/news-in-brief/2024-10-02/bribery-indictment-against-ex-broward-school-administrator-dismissed Bribery indictment against ex-Broward school administrator dismissed | WLRN Oct 2, 2024 - A judge has dismissed a bribery indictment against a former Broward County school administrator over allegations of unlawful compensation during his time with... school administratorbriberyindictmentexbroward https://radaronline.com/p/russell-simmons-demands-lawsuit-dismissed/ Russell Simmons Demands Sexual Assault Accuser Drew Dixon's Defamation Lawsuit Be Dismissed Apr 8, 2024 - Embattled Def Jam Records co-founder Russell Simmons is firing back to a lawsuit filed by a former executive, RadarOnline.com has learned, demanding for it to... russell simmonssexual assaultdrew dixondefamation lawsuitdemands https://orthodoxtimes.com/fr-christopher-metropulos-was-dismissed-as-president-of-hchc/ Fr. Christopher Metropulos was dismissed as President of HCHC | Orthodox Times (en) An anticipated change that had been reported months ago by romfea.gr took place a few hours ago. Specifically, Rev. Fr. Christopher T. Metropulos is no longer... frchristopherdismissedpresidentorthodox https://en.lb.ua/news/2022/04/12/12988_putin_dismissed_inhumane.html Putin dismissed the inhumane behaviour of the russian army in Ukraine - Chancellor of Austria Karl Nehammer flew to Putin to discuss peace and returned pessimistic. russian armyin ukraineputindismissedbehaviour https://thebuzzcincy.com/3107254/cardi-b-victorious-as-assault-lawsuit-dismissed-by-jury/?itm_source=thebuzzcincy.com&itm_medium=in_post&itm_campaign=related_content_widget&itm_content=well Cardi B Victorious As Assault Lawsuit Dismissed By Jury Sep 4, 2025 - Cardi B has been cleared of assault allegations in a $24M civil trial, ending a high-profile case from a 2018 incident. cardi bvictoriousassaultlawsuitdismissed https://www.justiceinfo.net/en/23677-en-en-260811-usarwanda-case-against-rwandan-genocide-suspect-dismissed-in-kansas1449114491.html 26.08.11 - USA/RWANDA - CASE AGAINST RWANDAN GENOCIDE SUSPECT DISMISSED IN KANSAS - JusticeInfo.net Aug 26, 2011 - Washington DC, August 26, 2011 (FH) - Prosecution on Friday dismissed all charges against Lazare Kobagaya, a 84-year old Rwandan accused of participating in... rwandan genocidein kansasusacasesuspect https://www.montanasports.com/politics/trump-indictments/judge-delays-sentencing-as-trump-pushes-to-have-hush-money-conviction-dismissed Judge delays sentencing as Trump pushes to have hush money conviction dismissed Nov 22, 2024 - President-elect Donald Trump was set to be sentenced on 34 counts of falsifying business records, but a New York judge has delayed that hearing indefinitely. to havejudgedelayssentencingtrump https://www.hilldickinson.com/our-view/articles/court-dismisses-challenge-to-arbitration-award-addressing-cargo-claims/ Challenge to arbitration award addressing cargo claims dismissed | Hill Dickinson This case highlights that challenges under s.68 of the Arbitration Act 1996 (1996 Act) to arbitration awards on the ground of serious irregularity leading... arbitration awardcargo claimschallengeaddressingdismissed https://talentrecap.com/pastor-who-dismissed-social-distancing-orders-dies-of-covid-19/ Pastor Who Dismissed Social Distancing Orders Dies Of COVID-19 Apr 1, 2022 - - Gerald Glenn, a pastor who dismissed social distancing orders during the coronavirus pandemic, has died of COVID-19. social distancingpastordismissedordersdies https://www.wkms.org/government-politics/2026-03-28/judge-dismissed-charges-against-officers-accused-of-falsifying-warrant-in-breonna-taylor-raid Judge dismissed charges against officers accused of falsifying warrant in Breonna Taylor raid | WKMS Mar 28, 2026 - The U.S. Department of Justice under President Donald Trump had moved to give up their prosecution of the two officers last week. breonna taylorjudgedismissedchargesofficers https://thegrio.com/2012/03/27/dismissed-sean-bell-cop-plans-legal-action-against-nypd/ Dismissed Sean Bell cop plans legal action against NYPD - TheGrio Mar 27, 2012 - Detective Gescard Isnora, one of the NYPD officers who shot and killed the unarmed Sean Bell, plans to take legal action after being fired last Friday... legal actiondismissedseanbellcop https://www.ctpublic.org/2021-07-29/harvey-weinstein-tries-and-fails-to-have-several-sexual-assault-charges-dismissed Harvey Weinstein Tries And Fails To Have Several Sexual Assault Charges Dismissed | Connecticut... Jul 29, 2021 - Weinstein's lawyers had asked a judge to throw out three of the sexual assault charges against him. The judge let two stand but agreed that a third should be... sexual assault chargesharvey weinsteinto havetriesfails https://supremetoday.ai/search/pending-amendment-application-court-pass-dismissed-stay-order Pending Amendment Application Court Pass Dismissed Stay Order AI-powered search results for agreements signed without authority. Explore key Indian judgments, summaries, and legal insights. pendingamendmentapplicationcourtpass https://en.iz.ru/en/1985007/2025-11-05/putin-dismissed-anton-gerasimov-post-deputy-head-russian-ministry-emergency-situations Putin dismissed Anton Gerasimov from the post of deputy head of the Russian Ministry of Emergency... Nov 5, 2025 - Russian President Vladimir Putin dismissed Anton Gerasimov from the post of deputy head of the Ministry of Emergency Situations of the Russian Federation. The... from theputindismissedantonpost https://www.cricketcountry.com/news/cape-cobras-vs-hobart-hurricanes-clt20-2014-match-6-at-hyderabad-ben-dunk-dismissed-for-54-190006/ Cape Cobras vs Hobart Hurricanes CLT20 2014 Match 6 at Hyderabad: Ben Dunk dismissed for 54 -... Sep 21, 2014 - Sep 21, 2014 Ben Dunk was dismissed for a well-made 54 for the Hobart Hurricanes against Cape Cobras in the sixth match of the Champions League T20 (CLT20)... cape cobrashobart hurricanesvsmatchhyderabad https://krod.com/former-utep-head-coach-sean-kugler-dismissed-by-arizona-cardinals/ Former UTEP head coach Sean Kugler Dismissed By Arizona Cardinals Arizona Cardinals offensive line coach/running game coordinator Sean Kugler was fired by the Arizona Cardinals for an incident that happened in Mexico City. head coacharizona cardinalsformerutepsean https://theclipout.com/459-peloton-bike-rust-lawsuit-officially-dismissed/ 459: Peloton Bike Rust Lawsuit Officially Dismissed - The Clip Out Apr 10, 2026 - Episode 459: Bike Rust lawsuit dismissed, Peloton IQ on Good Morning America, instructor highlights, and platform updates. peloton bikerustlawsuitofficiallydismissed https://gagrule.net/six-provincial-governors-dismissed-in-armenia/ Six provincial governors dismissed in Armenia - Gagrule.net Oct 5, 2018 - The Armenian government dismissed today six provincial governors from Tsarukyan bloc and the Armenian Revolutionary Federatioin/Dashnaktsutiun. On Tuesday,... provincial governorssixdismissedarmenia https://menafn.com/1111002094/Pakistans-Gandhara-Conference-Dismissed-As-Attempt-To-Monetise-Ruins-And-Not-Honour-Heritage-Report Pakistan's Gandhara Conference Dismissed As Attempt To Monetise Ruins And Not Honour Heritage:... Pakistan's Gandhara Conference Dismissed As Attempt To Monetise Ruins And Not Honour Heritage: Report. Islamabad, April 19 (IANS) Pakistan announced the... pakistangandharaconferencedismissedattempt https://www.freeadvice.com/legal/can-a-paternity-case-that-156833/ Can a paternity case that was heard and dismissed 7 years ago be reopened? | FreeAdvice Sep 12, 2012 - Paternity has already been established through that states courts but now we are being taken back into court for the same issue again, and the child is almost... years agopaternitycasehearddismissed https://www.newschannel5.com/news/national/favre-asks-to-be-dismissed-from-mississippi-welfare-lawsuit Favre asks to be dismissed from Mississippi welfare lawsuit Nov 29, 2022 - An attorney for Favre says the Mississippi Department of Human Services "groundlessly and irresponsibly seeks to blame Favre for its own grossly improper and... to beasksdismissedmississippiwelfare https://www.jackscamp.com/court-rules-district-courts-can-hear-mixed-cases-dismissed-lack-jurisdiction-justice-gorsuchs-first-dissent/ Court Rules That District Courts Can Hear Mixed Cases Dismissed For Lack Of Jurisdiction, Over... court rulesdistrict courtsmixed casesheardismissed https://kmmsam.com/students-dismissed-after-ammunition-found-in-missoula-school/ Students Dismissed After Ammunition Found in Missoula School Officials in a Montana high school have dismissed students early to conduct a thorough search of the school after a magazine of ammunition was found in a... studentsdismissedammunitionfoundmissoula https://www.buyclubtickets.com/event/class-dismissed-the-301-graduation-show/LvZ18QrhO75VO_ZZMaJV9 Class Dismissed: The 301 Graduation Show Tickets - May 7, 2026 - Norfolk, VA | BuyClubTickets.com Buy Class Dismissed: The 301 Graduation Show tickets in Norfolk, VA for May 7, 2026 class dismissedgraduation shownorfolk vaticketsmay https://christianleadermag.com/case-against-wall-dismissed/ Case against Wall dismissed - Christian Leader Oct 15, 2020 - The case against a former Pacific District Conference minister has been dismissed, according to Fresno County (California) court records. Gary Wall, former PDC... christian leadercasewalldismissed https://forum.magicduel.com/topic/12603-re-organisation-of-top-links/ Re-organisation of Top Links - Implemented or Dismissed - MagicDuel Community I dislike messiness, so im going to get some communtiy action and see what others think Ignoring all special links and such that LHO's have and such. i came to... top linksorganisationimplementeddismissedcommunity https://pure.amsterdamumc.nl/en/publications/do-deficiencies-in-canmeds-competencies-of-dismissed-residents-di/ Do deficiencies in CanMEDS competencies of dismissed residents differ according to specialty? -... according todeficienciescompetenciesdismissedresidents https://www.citizen.co.za/sedibeng-ster/news/2025/06/22/dismissed-radioman-announces-moja-love-contract-during-church/ Dismissed radioman announces Moja Love contract during church | Sedibeng Ster Jun 22, 2025 - Moja Love confirms DJ Finzo comeback to Giants of the City Season 4. dismissedannouncesmojalovecontract https://citizendiaryng.com/two-police-officers-dismiss-for-armed-robbery-official-corruption-illegal-duty/ Two police officers dismissed for armed robbery, official corruption, illegal duty - Citizendiary Jan 4, 2024 - The Assistant Inspector General of Police in charge of Zone 2 Command comprising Lagos and Ogun States, AIG Ari Muhammed Ali, PhD, has ordered the dismissal two police officersarmed robberydismissedofficialcorruption https://www.greghillassociates.com/la-municipal-code-violation-fence-height-case-dismissed.html LA Municipal Code Violation, Fence Height, Case Dismissed :: Los Angeles County Criminal Defense... los angeles countymunicipal codecriminal defenselafence https://thevotingnews.com/voter-id-law-frustrates-some-candidates-state-argues-lawsuit-should-be-dismissed-lubbock-avalanche-journal/ Texas: Voter ID law frustrates some candidates; state argues lawsuit should be dismissed | Lubbock... The new law requiring Texas voters show government-issued photo identification before casting a ballot is working as intended, according to state officials.... voter idtexaslawcandidatesstate https://www.toronto-dui-lawyer.ca/tag/how-many-dui-cases-are-dismissed-in-guelph/ How Many DUI Cases Are Dismissed in Guelph - Toronto DUI Lawyer How Many DUI Cases Are Dismissed in Guelph. We fight to win impaired driving charges, over 80 charges, care and control or multiple DUI offences. how manydui casesdismissedguelphtoronto https://www.lawfaremedia.org/article/more-kiobel-fall-out-foreign-defendants-dismissed-ats-apartheid-case-ford-and-ibm-remain-now More Kiobel Fall-out: Foreign Defendants Dismissed from ATS Apartheid Case But Ford and IBM Remain... The second day of Christmas has brought glad tidings for two defendants in the longest-running of all major ATS cases: earlier today, Judge Scheindlin... fallforeigndefendantsdismissedats https://artlyst.com/tag/dismissed/ Dismissed Archives - Artlyst dismissedarchives https://taxguru.in/corporate-law/rti-appeal-dismissed-information-public-domain.html RTI Appeal Dismissed as Information Already Available in Public Domain May 5, 2026 - The Authority held that information accessible on official websites need not be reproduced under RTI. The appeal was disposed of as the response had already... available inpublic domainrtiappealdismissed https://www.biharwatch.in/2026/05/frick-india-limiteds-slp-dismissed-as.html BiharWatch-Journal of Justice, Jurisprudence and Law: Frick India Limited's SLP dismissed as... The petition filed under under Order VI Rule 17 read with Section 151 of the Code of Civil Procedure was not maintainable if the same relief... journaljusticejurisprudencelawfrick https://loudwire.com/portion-chris-fehn-lawsuit-against-slipknot-business-manager-dismissed/ Part of Chris Fehn's Suit Against Slipknot's Ex-Manager Dismissed Shore can not be named individually, but his company remains named in the legal action. part ofchrisfehnsuitslipknot https://www.americanhealthlaw.org/content-library/ahla-daily/article/9f98613f-0485-468f-85f8-8f104f6faa7b/Lawsuit-From-Teaching-Hospital-Over-Medicare-Payme AHLA - Lawsuit From Teaching Hospital Over Medicare Payment Calculation Dismissed Lawsuit From Teaching Hospital Over Medicare Payment Calculation Dismissed teaching hospitalahlalawsuitmedicarepayment https://lawandcrime.com/covid-19-pandemic/sba-ran-out-of-money-one-week-after-pelosi-called-gop-request-for-more-aid-a-stunt/ SBA Ran Out of Funds a Week After Pelosi Dismissed Concerns | Law & Crime Apr 16, 2020 - The Small Business Administration (SBA) is officially out of novel Coronavirus (COVID-19) pandemic relief funds. Exactly one week earlier, House Speaker Nancy... out ofa weeklaw crimesbaran https://calabargist.com/cross-river-state-initiative-for-good-governance-dismissed-recent-claims-of-alphonsus-ogar-eba-on-gov-otu/ Cross River State Initiative for Good Governance Dismissed Recent claims of Alphonsus Ogar Eba On... Dec 24, 2025 - Cross River State Initiative for Good Governance has dismissed claims by Alphonsus Eba on Governor Otu's qualifications for 2023 elections. cross river statefor goodinitiativegovernancedismissed https://nytimespost.com/prosecutors-say-charlotte-train-stabbing-case-wont-be-dismissed-regardless-of-competency-ruling/ Prosecutors say Charlotte train stabbing case won't be dismissed regardless of competency ruling -... May 7, 2026 - NEWYou can now listen to Fox News articles! Federal prosecutors and defense attorneys are now aligned in pushing forward a competency determination for the man... prosecutorssaycharlottetrainstabbing https://thuglifearmy.com/index.php/editorials/3444-rap-artist-lawsuit-against-hip-hop-magazine-dismissed.html Rap Artist Lawsuit Against Hip Hop Magazine Dismissed ThugLife Army - A total news source for Hip-Hop cutlure hip hoprapartistlawsuitmagazine https://www.billsbills.com/blog/can-your-car-be-repossessed-if-your-chapter-13-dismissed-yes Can Your Car Be Repossessed If Your Chapter 13 Is Dismissed? Yes! If you used a Chapter 13 to save your car from repossession and then don't make your plan payments, you could see it take soon after your case is dismissed.... your carrepossessedchapterdismissedyes https://support.mozilla.org/ru/questions/972655 notifications aren't properly dismissed when multiple downloads are started from private tabs. |... notificationsproperlydismissedmultipledownloads https://www.jesuitnola.org/wild_photos/you-are-dismissed/ You Are Dismissed | Jesuit High School of New Orleans Seniors are dismissed from classes one final time at Jesuit. Senior Zach LaGraize and his classmates exploded out of Traditions Courtyard at the sound of the... you arehigh schoolnew orleansdismissed https://www.mgeko.cc/manga/mahoushi-ni-noranai-ijin/ Read A great man who does not appear in magic history ~Because he was dismissed from the Ministry... A great man who does not appear in magic history ~Because he was dismissed from the Ministry of Magic for his futile research, he was able to monopolize the... does not appeargreat manmagic historyfrom theread https://thewest.com.au/news/australia/appeal-dismissed-in-kl-drug-accused-case-ng-ya-373810 Appeal dismissed in KL drug accused case | The West Australian Jul 9, 2014 - A Malaysian court has dismissed an appeal against the acquittal of a WA man on drugs charges. the west australianappealdismissedkldrug https://www.fire.org/cases/university-nebraska-lincoln-lecturer-dismissed-after-showing-middle-finger-during-protest/documents University of Nebraska - Lincoln: Lecturer Dismissed After Showing Middle Finger During Protest |... university of nebraskamiddle fingerlincolnlecturerdismissed https://www.timesnownews.com/videos/mirror-now/shows/centres-plea-against-maggi-dismissed-indian-food-safety-laws-safe-enough-beyond-the-headline-video-109255344 Centre's Plea Against Maggi Dismissed | Indian Food Safety Laws 'Safe' Enough? | Beyond The... In today's episode of "Beyond the Headline," anchor Sneha Koshy untangles the legal complexities surrounding the iconic 2-minute noodles. Topics include... indian foodsafety lawscentrepleamaggi https://negrosnowdaily.com/plo-denies-mr-plea-of-4-dismissed-employees/ PLO denies MR plea of 4 dismissed employees Jan 24, 2023 - The motion for reconsideration (MR) filed by four Capitol employees, who were dismissed from service for grave misconduct, has been denied by the Provincial... plodeniesmrpleadismissed https://www.commercialmotor.com/compliance-news/article/olympic-scaffolding-revoked-licence-stands-after-appeal-dismissed Olympic Scaffolding revoked licence stands after appeal dismissed - Compliance News - Commercial... An appeal against a decision by deputy traffic commissioner (TC) John Baker to disqualify a director and revoke his O-licence has been dismissed after a... compliance newsolympicscaffoldingrevokedlicence https://www.ucs.org/resources/attacks-on-science/arms-control-panel-dismissed Arms Control Panel Dismissed | Union of Concerned Scientists After the George W. Bush administration came into office, the entire scientific committee that advised the State Department on technical matters related to... arms controlpaneldismissedunionconcerned https://www.3newsnow.com/news/national/lawsuit-against-the-nfl-to-change-outcome-of-nfc-title-game-dismissed NFL lawsuit dismissed by court Jan 31, 2019 - A federal judge threw out a lawsuit on Thursday after fans of the New Orleans Saints took the NFL to court after a botched call in the NFC title game. nfllawsuitdismissedcourt https://7220sports.com/breaking-dq-james-dismissed-from-wyoming-football-program/ BREAKING: DQ James Dismissed From Wyoming Football Program Speedy sophomore running back rushed for 452 yards in 12 games during his two-plus years in Laramie wyoming footballbreakingdqjamesdismissed https://isthebbcbiased.blogspot.com/2015/11/and-i-would-not-be-dismissed-with-of.html?m=0 Is the BBC biased?: "And I would not be dismissed with 'of course'" To lighten the mood, here's a 'Twitter spat' between a couple of BBC reporters - Rory Cellan-Jones and Hugh Sykes. It all starts with... the bbcand iof coursebiasedwould https://www.ynetnews.com/culture/article/hka8s9sir Jermaine Jenas dismissed from BBC over alleged inappropriate messages to female colle Aug 27, 2024 - Jenas, a regular studio pundit for BBC's Euros coverage, covered the 2020 Euros in Germany, acted as a co-commentator on a semi-final match and has been... from bbcdismissedallegedinappropriatemessages https://www.fox10phoenix.com/news/kristi-noem-suck-it-migrant-lawsuit-dismissed Kristi Noem's response after migrant lawsuit dismissed: 'Suck it' | FOX 10 Phoenix Homeland Security Secretary Kristi Noem offered a stunning two-word response to news that a group of migrants had dropped their lawsuit against her. kristi noemresponsemigrantlawsuitdismissed https://aws-ajax.com/2026/04/15/us-prasident-donald-trump-hat-erneut-eine-schlappe-vor-gericht-hinnehmen-mussen-/ Trump's defamation suit against WSJ dismissed: Judge rejects 'malicious intent' claim, sets April... malicious intenttrumpdefamationsuitwsj https://www.ultimatewindowssecurity.com/securitylog/encyclopedia/event.aspx?eventID=4803 Windows Security Log Event ID 4803 - The screen saver was dismissed windows securityscreen saverlogeventid https://www.jurist.org/news/2019/04/lawsuit-dismissed-against-social-media-companies-for-role-in-pulse-night-club-shooting/ Lawsuit dismissed against social media companies for role in Pulse Night Club shooting - JURIST -... The US Court of Appeals for the Sixth Circuit on Tuesday dismissed a lawsuit against Twitter, Facebook and Google brought by the victims and the families of... social media companiesnight clublawsuitdismissedrole https://scienceblogs.com/dispatches/2006/03/14/another-caldwell-nuisance-suit Another Caldwell Nuisance Suit Dismissed | ScienceBlogs Larry and Jeanne Caldwell, lawsuit filers extraordinaire, have had one dismissed. They sued over Berkeley's Understanding Evolution website, claiming that it... anothercaldwellnuisancesuitdismissed https://www.ccjdigital.com/business/article/14931235/volvo-trucks-global-head-persson-dismissed-following-stagnant-profitability Volvo Trucks global head Persson dismissed following stagnant profitability | Commercial Carrier... Volvo Group has dismissed Olof Persson as its president and chief executive, the company announced Wednesday. It also announced it plans to hire Scania boss... volvo trucksglobalheaddismissedfollowing https://wyomingstarnews.org/2024/09/06/australian-swimming-coach-dismissed-for-backing-korean-athlete-at-paris-olympics/ Australian Swimming Coach Dismissed for Backing Korean Athlete at Paris Olympics | Wyoming Star Sep 6, 2024 - Australian Swimming Coach Dismissed for Backing Korean Athlete at Paris Olympics - read 06.09.2024 at Wyoming Star. Stay informed with expert insights and... paris olympicsaustralianswimmingcoachdismissed https://globalnews.ca/news/5218911/alberta-gsa-lawsuit/ Appeal dismissed in challenge to Alberta gay-straight alliance law | Globalnews.ca Opponents of Alberta's law allowing gay-straight alliances in schools have been dealt another legal setback. gay straightappealdismissedchallengealberta https://www.danielpipes.org/comments/121205 Listened to it, dismissed it :: Reader comments at Daniel Pipes Listened to it, dismissed it :: Reader comments at Daniel Pipes reader commentsdaniel pipeslisteneddismissed https://www2.kusports.com/news/2005/mar/14/randle_dismissed_from/ Randle dismissed from football team - KU Sports Kansas Universitiy running back John Randle, who was arrested early Sunday morning after allegedly striking another man outside a downtown Lawrence bar and was... football teamdismissedkusports https://www.rcfp.org/defamation-lawsuit-aimed-silencing-journalist-daniel-coronell-should/ Defamation lawsuit aimed at silencing journalist Daniel Coronell should be dismissed, Reporters... Jan 29, 2025 - Reporters Committee for Freedom of the Press attorneys have asked a Florida state court to dismiss a defamation lawsuit against journalist and President of... defamation lawsuitaimedsilencingjournalistdaniel https://www.mtnewspapers.com/bitterroot-star-libel-suit-dismissed/ Bitterroot Star libel suit dismissed | Montana Newspaper Association Mar 22, 2018 - March 20, 2018, Bitterroot Star A federal district court judge has dismissed the case filed by former Ravalli County treasurer Valerie Stamey and bitterroot starlibelsuitdismissedmontana https://courtsnewsireland.ie/dangerous-driving-charge-against-ambulance-driver-dismissed-after-judge-watches-dash-cam-footage/2025/11/13/ Dangerous driving charge against ambulance driver dismissed after judge watches dash cam footage -... Nov 13, 2025 - A judge has dismissed a dangerous driving charge against an ambulance driver after finding that dashcam footage showed a learner motorist had unintentionally... dangerous drivingdash camchargeambulancedriver https://thesource.com/2025/08/08/shannon-sharpe-defamation-lawsuit-dismissed/ Shannon Sharpe and Ochocinco $20M Defamation Lawsuit Dismissed Aug 8, 2025 - The $20M defamation lawsuit against Shannon Sharpe and Ochocinco filed by Jimalita Tillman has been dismissed, with a resolution reached outside court. shannon sharpedefamation lawsuitdismissed https://www.trend.az/world/other/1402757.html Three dismissed over Polish prison death - Trend.Az Jan 20, 2009 - Three Polish justice officials were dismissed and another resigned on Tuesday amid the controversial suicide of a prisoner as Prime Minister Donald Tusk called... threedismissedpolishprisondeath https://www.omanobserver.om/article/1187222/scitech/technology/economists-once-dismissed-the-ai-job-threat-but-not-anymore Economists once dismissed the AI job threat, but not anymore - Oman Observer Among tech evangelists in Silicon Valley, it has become conventional wisdom that artificial intelligence will rapidly reshape the labor market, for... job threateconomistsdismissedaianymore https://www.indrastra.com/2017/02/BE-Made-in-USA-Lawsuit-Against-CVS-Health-Dismissed-003-02-2017-0044.html B&E | "Made in the U.S.A" Lawsuit against CVS Health is Dismissed The case is DeMedicis v CVS Health Corp et al, U.S. District Court, Northern District of Illinois, No. 16-05973. u s ab emade incvs healthlawsuit https://www.lawweb.in/2018/12/whether-suit-for-partition-is-barred-if.html Law Web: Whether suit for partition is barred if previous suit for partial partition was dismissed? lawwebwhethersuitpartition https://www.chinawiki.net/hot/liu-zhihong-was-expelled-from-the-party-and-dismissed-from-public-office.html Liu Zhihong was expelled from the party and dismissed from public office - ChinaWiki.Net On December 2nd, the official website of the Central Commission for Discipline Inspection and the National Supervisory Commission announced that Liu Zhihong, a... from the partypublic officeliuexpelleddismissed https://wnhub.io/news/other/item-49373 According to a report, Rockstar dismissed employees following discussions in an external Discord,... Nov 25, 2025 - According to a new report, Rockstar, the company behind Grand Theft Auto, has reportedly terminated 34 employees for "gross misconduct" following conversations... according toreportrockstardismissedemployees https://newsone.com/3756920/black-women-sexual-assault-empathy-harvey-weinstein-abuse/ Weinstein's Victims Win Sympathy While R.Kelly's Are Dismissed Jul 21, 2024 - Black female victims are too easily forgotten and ignored, explains Feminist writer Jamilah Lemieux. r kellyweinsteinvictimswinsympathy https://ijunkie.com/cydia-creators-lawsuit-against-apples-anti-competitive-behaviour-dismissed/ Cydia Creator's Lawsuit Against Apple's Anti-Competitive Behaviour Dismissed - iPhone Hacks | #1... Jan 6, 2022 - US District Judge Yvonne Gonzalez Rogers has dismissed the lawsuit filed against Apple by Cydia creator Jay Freeman. However, he has been given a January 19 cydiacreatorlawsuitappleanti https://www.wbrz.com/videos/charges-dismissed-against-suspect-accused-of-shooting-area-boxer Charges dismissed against suspect accused of shooting area boxer chargesdismissedsuspectaccusedshooting https://d1698.cms.socastsrm.com/2022/01/25/alec-baldwin-argues-that-civil-lawsuit-regarding-fatal-rust-shooting-should-be-dismissed/ Alec Baldwin Argues That Civil Lawsuit Regarding Fatal Rust Shooting Should Be Dismissed |... Alec Baldwin and other producers of Rust filed a motion on Monday (January 24th) to dismiss a civil lawsuit brought forth by the movie's script supervisor,... alec baldwincivil lawsuitarguesregardingfatal https://theiowastandard.com/2020-higher-ed-isu-professor-warns-students-will-be-dismissed-if-they-disagree-with-her-on-gay-marriage-abortion-blm/ 2020: HIGHER ED - ISU professor warns students will be dismissed if they disagree with her on gay... Dec 24, 2020 - ***We are republishing our most popular stories from 2020. We hope you enjoy this look back! If you appreciate what The Iowa Standard does, please consider... higher edisuprofessorwarnsstudents