https://classdismissed.us/
Class Dismissed
Class Dismissed - AR Experience
class dismissed
https://www.hivjustice.net/cases/us-charges-of-alleged-hiv-non-disclosure-dismissed-for-the-second-time-in-michigan-against-undetectable-transgender-woman/
US: Charges of alleged HIV non-disclosure dismissed for the second time in Michigan against...
The HIV Justice Network (HJN) is the leading community-based NGO building a co-ordinated, effective global response to punitive laws and policies that impact...
for the secondtime inuschargesalleged
https://www.wklaw.com/question/i-was-arrested-for-dui-this-past-weekend-but-the-officer-never-read-me-my-miranda-rights-can-i-get-the-case-thrown-out/
No Miranda Rights: Can DUI Case Be Dismissed?
Dec 5, 2024 - Arrested for DUI without being read your Miranda rights? Discover when this can impact your case and explore potential defense options.
miranda rightsduicasedismissed
https://nahoumlaw.com/us-equities-judgment-voluntarily-vacated-lawsuit-dismissed-two-2-states-due-sewer-service/
US Equities Judgment Voluntarily Vacated and Lawsuit Dismissed in Two 2 States Due to Sewer Service...
Dec 14, 2023 - Our client discovered that 2 default judgments were entered against him in NY and Ct. by junk debt buyer U.S. Equities Corp. for more that $14,000.00.
sewer serviceusequitiesjudgmentvacated
https://allmandlaw.com/texas-bankruptcy-faqs/my-bankruptcy-case-was-dismissed-what-do-i-do-now/
My Bankruptcy Case Was Dismissed, What Do I Do Now? - Allmand Law Firm, PLLC
law firmbankruptcycasedismissedallmand
https://www.carcomplaints.com/news/2026/chrysler-300-dodge-charger-door-panel-warp-lawsuit-dismissed.shtml
Chrysler 300, Dodge Charger Door Panel Warp Lawsuit Dismissed | CarComplaints.com
A Chrysler 300 and Dodge Charger warped door panel class action lawsuit has been dismissed after years in court. The original warped panel class action lawsuit...
dodge chargerdoor panelchryslerwarplawsuit
https://www.classaction.org/news/nfl-team-websites-illegally-shared-subscriber-data-with-facebook-class-action-claims
NFL Team Websites Illegally Shared Subscriber Data with Facebook, Class Action Claims [DISMISSED]
Oct 5, 2023 - A class action alleges the websites for each NFL team have unlawfully shared the personal identifying information of newsletter subscribers with Facebook...
class action claimsnfl teamwebsitesillegallyshared
https://www.dabangasudan.org/en/all-news/article/journalists-detained-and-dismissed-in-sudan
Journalists detained and dismissed in Sudan - Dabanga Radio TV Online
Jun 20, 2019 - Two Sudanese journalists were detained on Monday. The editor-in-chief of El Sayha newspaper was dismissed. Many journalists at the official media channels were...
tv onlinejournalistsdetaineddismissedsudan
https://townofnorway.org/5-reasons-microsoft-dismissed-world-of-warcraft-on-game-pass/
5 Reasons Microsoft Dismissed World Of Warcraft On Game Pass - Townofnorway
Oct 11, 2025 - Microsoft has recently addressed the ongoing speculation surrounding the availability of World of Warcraft on its Xbox Game Pass service. With the gaming
world of warcraftgame passreasonsmicrosoftdismissed
https://bfsi.economictimes.indiatimes.com/news/fintech/pils-against-operations-of-google-pay-dismissed-by-hc/102885658
PILs against operations of Google Pay dismissed by HC, ETBFSI
Dismissing the petitions, a bench headed by Chief Justice Satish Chandra Sharma said Google Pay is "mere third-party app provider" which requires no...
google paypilsoperationsdismissedhc
https://www.wlrn.org/news-in-brief/2024-10-02/bribery-indictment-against-ex-broward-school-administrator-dismissed
Bribery indictment against ex-Broward school administrator dismissed | WLRN
Oct 2, 2024 - A judge has dismissed a bribery indictment against a former Broward County school administrator over allegations of unlawful compensation during his time with...
school administratorbriberyindictmentexbroward
https://radaronline.com/p/russell-simmons-demands-lawsuit-dismissed/
Russell Simmons Demands Sexual Assault Accuser Drew Dixon's Defamation Lawsuit Be Dismissed
Apr 8, 2024 - Embattled Def Jam Records co-founder Russell Simmons is firing back to a lawsuit filed by a former executive, RadarOnline.com has learned, demanding for it to...
russell simmonssexual assaultdrew dixondefamation lawsuitdemands
https://orthodoxtimes.com/fr-christopher-metropulos-was-dismissed-as-president-of-hchc/
Fr. Christopher Metropulos was dismissed as President of HCHC | Orthodox Times (en)
An anticipated change that had been reported months ago by romfea.gr took place a few hours ago. Specifically, Rev. Fr. Christopher T. Metropulos is no longer...
frchristopherdismissedpresidentorthodox
https://en.lb.ua/news/2022/04/12/12988_putin_dismissed_inhumane.html
Putin dismissed the inhumane behaviour of the russian army in Ukraine - Chancellor of Austria
Karl Nehammer flew to Putin to discuss peace and returned pessimistic.
russian armyin ukraineputindismissedbehaviour
https://thebuzzcincy.com/3107254/cardi-b-victorious-as-assault-lawsuit-dismissed-by-jury/?itm_source=thebuzzcincy.com&itm_medium=in_post&itm_campaign=related_content_widget&itm_content=well
Cardi B Victorious As Assault Lawsuit Dismissed By Jury
Sep 4, 2025 - Cardi B has been cleared of assault allegations in a $24M civil trial, ending a high-profile case from a 2018 incident.
cardi bvictoriousassaultlawsuitdismissed
https://www.justiceinfo.net/en/23677-en-en-260811-usarwanda-case-against-rwandan-genocide-suspect-dismissed-in-kansas1449114491.html
26.08.11 - USA/RWANDA - CASE AGAINST RWANDAN GENOCIDE SUSPECT DISMISSED IN KANSAS - JusticeInfo.net
Aug 26, 2011 - Washington DC, August 26, 2011 (FH) - Prosecution on Friday dismissed all charges against Lazare Kobagaya, a 84-year old Rwandan accused of participating in...
rwandan genocidein kansasusacasesuspect
https://www.montanasports.com/politics/trump-indictments/judge-delays-sentencing-as-trump-pushes-to-have-hush-money-conviction-dismissed
Judge delays sentencing as Trump pushes to have hush money conviction dismissed
Nov 22, 2024 - President-elect Donald Trump was set to be sentenced on 34 counts of falsifying business records, but a New York judge has delayed that hearing indefinitely.
to havejudgedelayssentencingtrump
https://www.hilldickinson.com/our-view/articles/court-dismisses-challenge-to-arbitration-award-addressing-cargo-claims/
Challenge to arbitration award addressing cargo claims dismissed | Hill Dickinson
This case highlights that challenges under s.68 of the Arbitration Act 1996 (1996 Act) to arbitration awards on the ground of serious irregularity leading...
arbitration awardcargo claimschallengeaddressingdismissed
https://talentrecap.com/pastor-who-dismissed-social-distancing-orders-dies-of-covid-19/
Pastor Who Dismissed Social Distancing Orders Dies Of COVID-19
Apr 1, 2022 - - Gerald Glenn, a pastor who dismissed social distancing orders during the coronavirus pandemic, has died of COVID-19.
social distancingpastordismissedordersdies
https://www.wkms.org/government-politics/2026-03-28/judge-dismissed-charges-against-officers-accused-of-falsifying-warrant-in-breonna-taylor-raid
Judge dismissed charges against officers accused of falsifying warrant in Breonna Taylor raid | WKMS
Mar 28, 2026 - The U.S. Department of Justice under President Donald Trump had moved to give up their prosecution of the two officers last week.
breonna taylorjudgedismissedchargesofficers
https://thegrio.com/2012/03/27/dismissed-sean-bell-cop-plans-legal-action-against-nypd/
Dismissed Sean Bell cop plans legal action against NYPD - TheGrio
Mar 27, 2012 - Detective Gescard Isnora, one of the NYPD officers who shot and killed the unarmed Sean Bell, plans to take legal action after being fired last Friday...
legal actiondismissedseanbellcop
https://www.ctpublic.org/2021-07-29/harvey-weinstein-tries-and-fails-to-have-several-sexual-assault-charges-dismissed
Harvey Weinstein Tries And Fails To Have Several Sexual Assault Charges Dismissed | Connecticut...
Jul 29, 2021 - Weinstein's lawyers had asked a judge to throw out three of the sexual assault charges against him. The judge let two stand but agreed that a third should be...
sexual assault chargesharvey weinsteinto havetriesfails
https://supremetoday.ai/search/pending-amendment-application-court-pass-dismissed-stay-order
Pending Amendment Application Court Pass Dismissed Stay Order
AI-powered search results for agreements signed without authority. Explore key Indian judgments, summaries, and legal insights.
pendingamendmentapplicationcourtpass
https://en.iz.ru/en/1985007/2025-11-05/putin-dismissed-anton-gerasimov-post-deputy-head-russian-ministry-emergency-situations
Putin dismissed Anton Gerasimov from the post of deputy head of the Russian Ministry of Emergency...
Nov 5, 2025 - Russian President Vladimir Putin dismissed Anton Gerasimov from the post of deputy head of the Ministry of Emergency Situations of the Russian Federation. The...
from theputindismissedantonpost
https://www.cricketcountry.com/news/cape-cobras-vs-hobart-hurricanes-clt20-2014-match-6-at-hyderabad-ben-dunk-dismissed-for-54-190006/
Cape Cobras vs Hobart Hurricanes CLT20 2014 Match 6 at Hyderabad: Ben Dunk dismissed for 54 -...
Sep 21, 2014 - Sep 21, 2014 Ben Dunk was dismissed for a well-made 54 for the Hobart Hurricanes against Cape Cobras in the sixth match of the Champions League T20 (CLT20)...
cape cobrashobart hurricanesvsmatchhyderabad
https://krod.com/former-utep-head-coach-sean-kugler-dismissed-by-arizona-cardinals/
Former UTEP head coach Sean Kugler Dismissed By Arizona Cardinals
Arizona Cardinals offensive line coach/running game coordinator Sean Kugler was fired by the Arizona Cardinals for an incident that happened in Mexico City.
head coacharizona cardinalsformerutepsean
https://theclipout.com/459-peloton-bike-rust-lawsuit-officially-dismissed/
459: Peloton Bike Rust Lawsuit Officially Dismissed - The Clip Out
Apr 10, 2026 - Episode 459: Bike Rust lawsuit dismissed, Peloton IQ on Good Morning America, instructor highlights, and platform updates.
peloton bikerustlawsuitofficiallydismissed
https://gagrule.net/six-provincial-governors-dismissed-in-armenia/
Six provincial governors dismissed in Armenia - Gagrule.net
Oct 5, 2018 - The Armenian government dismissed today six provincial governors from Tsarukyan bloc and the Armenian Revolutionary Federatioin/Dashnaktsutiun. On Tuesday,...
provincial governorssixdismissedarmenia
https://menafn.com/1111002094/Pakistans-Gandhara-Conference-Dismissed-As-Attempt-To-Monetise-Ruins-And-Not-Honour-Heritage-Report
Pakistan's Gandhara Conference Dismissed As Attempt To Monetise Ruins And Not Honour Heritage:...
Pakistan's Gandhara Conference Dismissed As Attempt To Monetise Ruins And Not Honour Heritage: Report. Islamabad, April 19 (IANS) Pakistan announced the...
pakistangandharaconferencedismissedattempt
https://www.freeadvice.com/legal/can-a-paternity-case-that-156833/
Can a paternity case that was heard and dismissed 7 years ago be reopened? | FreeAdvice
Sep 12, 2012 - Paternity has already been established through that states courts but now we are being taken back into court for the same issue again, and the child is almost...
years agopaternitycasehearddismissed
https://www.newschannel5.com/news/national/favre-asks-to-be-dismissed-from-mississippi-welfare-lawsuit
Favre asks to be dismissed from Mississippi welfare lawsuit
Nov 29, 2022 - An attorney for Favre says the Mississippi Department of Human Services "groundlessly and irresponsibly seeks to blame Favre for its own grossly improper and...
to beasksdismissedmississippiwelfare
https://www.jackscamp.com/court-rules-district-courts-can-hear-mixed-cases-dismissed-lack-jurisdiction-justice-gorsuchs-first-dissent/
Court Rules That District Courts Can Hear Mixed Cases Dismissed For Lack Of Jurisdiction, Over...
court rulesdistrict courtsmixed casesheardismissed
https://kmmsam.com/students-dismissed-after-ammunition-found-in-missoula-school/
Students Dismissed After Ammunition Found in Missoula School
Officials in a Montana high school have dismissed students early to conduct a thorough search of the school after a magazine of ammunition was found in a...
studentsdismissedammunitionfoundmissoula
https://www.buyclubtickets.com/event/class-dismissed-the-301-graduation-show/LvZ18QrhO75VO_ZZMaJV9
Class Dismissed: The 301 Graduation Show Tickets - May 7, 2026 - Norfolk, VA | BuyClubTickets.com
Buy Class Dismissed: The 301 Graduation Show tickets in Norfolk, VA for May 7, 2026
class dismissedgraduation shownorfolk vaticketsmay
https://christianleadermag.com/case-against-wall-dismissed/
Case against Wall dismissed - Christian Leader
Oct 15, 2020 - The case against a former Pacific District Conference minister has been dismissed, according to Fresno County (California) court records. Gary Wall, former PDC...
christian leadercasewalldismissed
https://forum.magicduel.com/topic/12603-re-organisation-of-top-links/
Re-organisation of Top Links - Implemented or Dismissed - MagicDuel Community
I dislike messiness, so im going to get some communtiy action and see what others think Ignoring all special links and such that LHO's have and such. i came to...
top linksorganisationimplementeddismissedcommunity
https://pure.amsterdamumc.nl/en/publications/do-deficiencies-in-canmeds-competencies-of-dismissed-residents-di/
Do deficiencies in CanMEDS competencies of dismissed residents differ according to specialty? -...
according todeficienciescompetenciesdismissedresidents
https://www.citizen.co.za/sedibeng-ster/news/2025/06/22/dismissed-radioman-announces-moja-love-contract-during-church/
Dismissed radioman announces Moja Love contract during church | Sedibeng Ster
Jun 22, 2025 - Moja Love confirms DJ Finzo comeback to Giants of the City Season 4.
dismissedannouncesmojalovecontract
https://citizendiaryng.com/two-police-officers-dismiss-for-armed-robbery-official-corruption-illegal-duty/
Two police officers dismissed for armed robbery, official corruption, illegal duty - Citizendiary
Jan 4, 2024 - The Assistant Inspector General of Police in charge of Zone 2 Command comprising Lagos and Ogun States, AIG Ari Muhammed Ali, PhD, has ordered the dismissal
two police officersarmed robberydismissedofficialcorruption
https://www.greghillassociates.com/la-municipal-code-violation-fence-height-case-dismissed.html
LA Municipal Code Violation, Fence Height, Case Dismissed :: Los Angeles County Criminal Defense...
los angeles countymunicipal codecriminal defenselafence
https://thevotingnews.com/voter-id-law-frustrates-some-candidates-state-argues-lawsuit-should-be-dismissed-lubbock-avalanche-journal/
Texas: Voter ID law frustrates some candidates; state argues lawsuit should be dismissed | Lubbock...
The new law requiring Texas voters show government-issued photo identification before casting a ballot is working as intended, according to state officials....
voter idtexaslawcandidatesstate
https://www.toronto-dui-lawyer.ca/tag/how-many-dui-cases-are-dismissed-in-guelph/
How Many DUI Cases Are Dismissed in Guelph - Toronto DUI Lawyer
How Many DUI Cases Are Dismissed in Guelph. We fight to win impaired driving charges, over 80 charges, care and control or multiple DUI offences.
how manydui casesdismissedguelphtoronto
https://www.lawfaremedia.org/article/more-kiobel-fall-out-foreign-defendants-dismissed-ats-apartheid-case-ford-and-ibm-remain-now
More Kiobel Fall-out: Foreign Defendants Dismissed from ATS Apartheid Case But Ford and IBM Remain...
The second day of Christmas has brought glad tidings for two defendants in the longest-running of all major ATS cases: earlier today, Judge Scheindlin...
fallforeigndefendantsdismissedats
https://artlyst.com/tag/dismissed/
Dismissed Archives - Artlyst
dismissedarchives
https://taxguru.in/corporate-law/rti-appeal-dismissed-information-public-domain.html
RTI Appeal Dismissed as Information Already Available in Public Domain
May 5, 2026 - The Authority held that information accessible on official websites need not be reproduced under RTI. The appeal was disposed of as the response had already...
available inpublic domainrtiappealdismissed
https://www.biharwatch.in/2026/05/frick-india-limiteds-slp-dismissed-as.html
BiharWatch-Journal of Justice, Jurisprudence and Law: Frick India Limited's SLP dismissed as...
The petition filed under under Order VI Rule 17 read with Section 151 of the Code of Civil Procedure was not maintainable if the same relief...
journaljusticejurisprudencelawfrick
https://loudwire.com/portion-chris-fehn-lawsuit-against-slipknot-business-manager-dismissed/
Part of Chris Fehn's Suit Against Slipknot's Ex-Manager Dismissed
Shore can not be named individually, but his company remains named in the legal action.
part ofchrisfehnsuitslipknot
https://www.americanhealthlaw.org/content-library/ahla-daily/article/9f98613f-0485-468f-85f8-8f104f6faa7b/Lawsuit-From-Teaching-Hospital-Over-Medicare-Payme
AHLA - Lawsuit From Teaching Hospital Over Medicare Payment Calculation Dismissed
Lawsuit From Teaching Hospital Over Medicare Payment Calculation Dismissed
teaching hospitalahlalawsuitmedicarepayment
https://lawandcrime.com/covid-19-pandemic/sba-ran-out-of-money-one-week-after-pelosi-called-gop-request-for-more-aid-a-stunt/
SBA Ran Out of Funds a Week After Pelosi Dismissed Concerns | Law & Crime
Apr 16, 2020 - The Small Business Administration (SBA) is officially out of novel Coronavirus (COVID-19) pandemic relief funds. Exactly one week earlier, House Speaker Nancy...
out ofa weeklaw crimesbaran
https://calabargist.com/cross-river-state-initiative-for-good-governance-dismissed-recent-claims-of-alphonsus-ogar-eba-on-gov-otu/
Cross River State Initiative for Good Governance Dismissed Recent claims of Alphonsus Ogar Eba On...
Dec 24, 2025 - Cross River State Initiative for Good Governance has dismissed claims by Alphonsus Eba on Governor Otu's qualifications for 2023 elections.
cross river statefor goodinitiativegovernancedismissed
https://nytimespost.com/prosecutors-say-charlotte-train-stabbing-case-wont-be-dismissed-regardless-of-competency-ruling/
Prosecutors say Charlotte train stabbing case won't be dismissed regardless of competency ruling -...
May 7, 2026 - NEWYou can now listen to Fox News articles! Federal prosecutors and defense attorneys are now aligned in pushing forward a competency determination for the man...
prosecutorssaycharlottetrainstabbing
https://thuglifearmy.com/index.php/editorials/3444-rap-artist-lawsuit-against-hip-hop-magazine-dismissed.html
Rap Artist Lawsuit Against Hip Hop Magazine Dismissed
ThugLife Army - A total news source for Hip-Hop cutlure
hip hoprapartistlawsuitmagazine
https://www.billsbills.com/blog/can-your-car-be-repossessed-if-your-chapter-13-dismissed-yes
Can Your Car Be Repossessed If Your Chapter 13 Is Dismissed? Yes!
If you used a Chapter 13 to save your car from repossession and then don't make your plan payments, you could see it take soon after your case is dismissed....
your carrepossessedchapterdismissedyes
https://support.mozilla.org/ru/questions/972655
notifications aren't properly dismissed when multiple downloads are started from private tabs. |...
notificationsproperlydismissedmultipledownloads
https://www.jesuitnola.org/wild_photos/you-are-dismissed/
You Are Dismissed | Jesuit High School of New Orleans
Seniors are dismissed from classes one final time at Jesuit. Senior Zach LaGraize and his classmates exploded out of Traditions Courtyard at the sound of the...
you arehigh schoolnew orleansdismissed
https://www.mgeko.cc/manga/mahoushi-ni-noranai-ijin/
Read A great man who does not appear in magic history ~Because he was dismissed from the Ministry...
A great man who does not appear in magic history ~Because he was dismissed from the Ministry of Magic for his futile research, he was able to monopolize the...
does not appeargreat manmagic historyfrom theread
https://thewest.com.au/news/australia/appeal-dismissed-in-kl-drug-accused-case-ng-ya-373810
Appeal dismissed in KL drug accused case | The West Australian
Jul 9, 2014 - A Malaysian court has dismissed an appeal against the acquittal of a WA man on drugs charges.
the west australianappealdismissedkldrug
https://www.fire.org/cases/university-nebraska-lincoln-lecturer-dismissed-after-showing-middle-finger-during-protest/documents
University of Nebraska - Lincoln: Lecturer Dismissed After Showing Middle Finger During Protest |...
university of nebraskamiddle fingerlincolnlecturerdismissed
https://www.timesnownews.com/videos/mirror-now/shows/centres-plea-against-maggi-dismissed-indian-food-safety-laws-safe-enough-beyond-the-headline-video-109255344
Centre's Plea Against Maggi Dismissed | Indian Food Safety Laws 'Safe' Enough? | Beyond The...
In today's episode of "Beyond the Headline," anchor Sneha Koshy untangles the legal complexities surrounding the iconic 2-minute noodles. Topics include...
indian foodsafety lawscentrepleamaggi
https://negrosnowdaily.com/plo-denies-mr-plea-of-4-dismissed-employees/
PLO denies MR plea of 4 dismissed employees
Jan 24, 2023 - The motion for reconsideration (MR) filed by four Capitol employees, who were dismissed from service for grave misconduct, has been denied by the Provincial...
plodeniesmrpleadismissed
https://www.commercialmotor.com/compliance-news/article/olympic-scaffolding-revoked-licence-stands-after-appeal-dismissed
Olympic Scaffolding revoked licence stands after appeal dismissed - Compliance News - Commercial...
An appeal against a decision by deputy traffic commissioner (TC) John Baker to disqualify a director and revoke his O-licence has been dismissed after a...
compliance newsolympicscaffoldingrevokedlicence
https://www.ucs.org/resources/attacks-on-science/arms-control-panel-dismissed
Arms Control Panel Dismissed | Union of Concerned Scientists
After the George W. Bush administration came into office, the entire scientific committee that advised the State Department on technical matters related to...
arms controlpaneldismissedunionconcerned
https://www.3newsnow.com/news/national/lawsuit-against-the-nfl-to-change-outcome-of-nfc-title-game-dismissed
NFL lawsuit dismissed by court
Jan 31, 2019 - A federal judge threw out a lawsuit on Thursday after fans of the New Orleans Saints took the NFL to court after a botched call in the NFC title game.
nfllawsuitdismissedcourt
https://7220sports.com/breaking-dq-james-dismissed-from-wyoming-football-program/
BREAKING: DQ James Dismissed From Wyoming Football Program
Speedy sophomore running back rushed for 452 yards in 12 games during his two-plus years in Laramie
wyoming footballbreakingdqjamesdismissed
https://isthebbcbiased.blogspot.com/2015/11/and-i-would-not-be-dismissed-with-of.html?m=0
Is the BBC biased?: "And I would not be dismissed with 'of course'"
To lighten the mood, here's a 'Twitter spat' between a couple of BBC reporters - Rory Cellan-Jones and Hugh Sykes. It all starts with...
the bbcand iof coursebiasedwould
https://www.ynetnews.com/culture/article/hka8s9sir
Jermaine Jenas dismissed from BBC over alleged inappropriate messages to female colle
Aug 27, 2024 - Jenas, a regular studio pundit for BBC's Euros coverage, covered the 2020 Euros in Germany, acted as a co-commentator on a semi-final match and has been...
from bbcdismissedallegedinappropriatemessages
https://www.fox10phoenix.com/news/kristi-noem-suck-it-migrant-lawsuit-dismissed
Kristi Noem's response after migrant lawsuit dismissed: 'Suck it' | FOX 10 Phoenix
Homeland Security Secretary Kristi Noem offered a stunning two-word response to news that a group of migrants had dropped their lawsuit against her.
kristi noemresponsemigrantlawsuitdismissed
https://aws-ajax.com/2026/04/15/us-prasident-donald-trump-hat-erneut-eine-schlappe-vor-gericht-hinnehmen-mussen-/
Trump's defamation suit against WSJ dismissed: Judge rejects 'malicious intent' claim, sets April...
malicious intenttrumpdefamationsuitwsj
https://www.ultimatewindowssecurity.com/securitylog/encyclopedia/event.aspx?eventID=4803
Windows Security Log Event ID 4803 - The screen saver was dismissed
windows securityscreen saverlogeventid
https://www.jurist.org/news/2019/04/lawsuit-dismissed-against-social-media-companies-for-role-in-pulse-night-club-shooting/
Lawsuit dismissed against social media companies for role in Pulse Night Club shooting - JURIST -...
The US Court of Appeals for the Sixth Circuit on Tuesday dismissed a lawsuit against Twitter, Facebook and Google brought by the victims and the families of...
social media companiesnight clublawsuitdismissedrole
https://scienceblogs.com/dispatches/2006/03/14/another-caldwell-nuisance-suit
Another Caldwell Nuisance Suit Dismissed | ScienceBlogs
Larry and Jeanne Caldwell, lawsuit filers extraordinaire, have had one dismissed. They sued over Berkeley's Understanding Evolution website, claiming that it...
anothercaldwellnuisancesuitdismissed
https://www.ccjdigital.com/business/article/14931235/volvo-trucks-global-head-persson-dismissed-following-stagnant-profitability
Volvo Trucks global head Persson dismissed following stagnant profitability | Commercial Carrier...
Volvo Group has dismissed Olof Persson as its president and chief executive, the company announced Wednesday. It also announced it plans to hire Scania boss...
volvo trucksglobalheaddismissedfollowing
https://wyomingstarnews.org/2024/09/06/australian-swimming-coach-dismissed-for-backing-korean-athlete-at-paris-olympics/
Australian Swimming Coach Dismissed for Backing Korean Athlete at Paris Olympics | Wyoming Star
Sep 6, 2024 - Australian Swimming Coach Dismissed for Backing Korean Athlete at Paris Olympics - read 06.09.2024 at Wyoming Star. Stay informed with expert insights and...
paris olympicsaustralianswimmingcoachdismissed
https://globalnews.ca/news/5218911/alberta-gsa-lawsuit/
Appeal dismissed in challenge to Alberta gay-straight alliance law | Globalnews.ca
Opponents of Alberta's law allowing gay-straight alliances in schools have been dealt another legal setback.
gay straightappealdismissedchallengealberta
https://www.danielpipes.org/comments/121205
Listened to it, dismissed it :: Reader comments at Daniel Pipes
Listened to it, dismissed it :: Reader comments at Daniel Pipes
reader commentsdaniel pipeslisteneddismissed
https://www2.kusports.com/news/2005/mar/14/randle_dismissed_from/
Randle dismissed from football team - KU Sports
Kansas Universitiy running back John Randle, who was arrested early Sunday morning after allegedly striking another man outside a downtown Lawrence bar and was...
football teamdismissedkusports
https://www.rcfp.org/defamation-lawsuit-aimed-silencing-journalist-daniel-coronell-should/
Defamation lawsuit aimed at silencing journalist Daniel Coronell should be dismissed, Reporters...
Jan 29, 2025 - Reporters Committee for Freedom of the Press attorneys have asked a Florida state court to dismiss a defamation lawsuit against journalist and President of...
defamation lawsuitaimedsilencingjournalistdaniel
https://www.mtnewspapers.com/bitterroot-star-libel-suit-dismissed/
Bitterroot Star libel suit dismissed | Montana Newspaper Association
Mar 22, 2018 - March 20, 2018, Bitterroot Star A federal district court judge has dismissed the case filed by former Ravalli County treasurer Valerie Stamey and
bitterroot starlibelsuitdismissedmontana
https://courtsnewsireland.ie/dangerous-driving-charge-against-ambulance-driver-dismissed-after-judge-watches-dash-cam-footage/2025/11/13/
Dangerous driving charge against ambulance driver dismissed after judge watches dash cam footage -...
Nov 13, 2025 - A judge has dismissed a dangerous driving charge against an ambulance driver after finding that dashcam footage showed a learner motorist had unintentionally...
dangerous drivingdash camchargeambulancedriver
https://thesource.com/2025/08/08/shannon-sharpe-defamation-lawsuit-dismissed/
Shannon Sharpe and Ochocinco $20M Defamation Lawsuit Dismissed
Aug 8, 2025 - The $20M defamation lawsuit against Shannon Sharpe and Ochocinco filed by Jimalita Tillman has been dismissed, with a resolution reached outside court.
shannon sharpedefamation lawsuitdismissed
https://www.trend.az/world/other/1402757.html
Three dismissed over Polish prison death - Trend.Az
Jan 20, 2009 - Three Polish justice officials were dismissed and another resigned on Tuesday amid the controversial suicide of a prisoner as Prime Minister Donald Tusk called...
threedismissedpolishprisondeath
https://www.omanobserver.om/article/1187222/scitech/technology/economists-once-dismissed-the-ai-job-threat-but-not-anymore
Economists once dismissed the AI job threat, but not anymore - Oman Observer
Among tech evangelists in Silicon Valley, it has become conventional wisdom that artificial intelligence will rapidly reshape the labor market, for...
job threateconomistsdismissedaianymore
https://www.indrastra.com/2017/02/BE-Made-in-USA-Lawsuit-Against-CVS-Health-Dismissed-003-02-2017-0044.html
B&E | "Made in the U.S.A" Lawsuit against CVS Health is Dismissed
The case is DeMedicis v CVS Health Corp et al, U.S. District Court, Northern District of Illinois, No. 16-05973.
u s ab emade incvs healthlawsuit
https://www.lawweb.in/2018/12/whether-suit-for-partition-is-barred-if.html
Law Web: Whether suit for partition is barred if previous suit for partial partition was dismissed?
lawwebwhethersuitpartition
https://www.chinawiki.net/hot/liu-zhihong-was-expelled-from-the-party-and-dismissed-from-public-office.html
Liu Zhihong was expelled from the party and dismissed from public office - ChinaWiki.Net
On December 2nd, the official website of the Central Commission for Discipline Inspection and the National Supervisory Commission announced that Liu Zhihong, a...
from the partypublic officeliuexpelleddismissed
https://wnhub.io/news/other/item-49373
According to a report, Rockstar dismissed employees following discussions in an external Discord,...
Nov 25, 2025 - According to a new report, Rockstar, the company behind Grand Theft Auto, has reportedly terminated 34 employees for "gross misconduct" following conversations...
according toreportrockstardismissedemployees
https://newsone.com/3756920/black-women-sexual-assault-empathy-harvey-weinstein-abuse/
Weinstein's Victims Win Sympathy While R.Kelly's Are Dismissed
Jul 21, 2024 - Black female victims are too easily forgotten and ignored, explains Feminist writer Jamilah Lemieux.
r kellyweinsteinvictimswinsympathy
https://ijunkie.com/cydia-creators-lawsuit-against-apples-anti-competitive-behaviour-dismissed/
Cydia Creator's Lawsuit Against Apple's Anti-Competitive Behaviour Dismissed - iPhone Hacks | #1...
Jan 6, 2022 - US District Judge Yvonne Gonzalez Rogers has dismissed the lawsuit filed against Apple by Cydia creator Jay Freeman. However, he has been given a January 19
cydiacreatorlawsuitappleanti
https://www.wbrz.com/videos/charges-dismissed-against-suspect-accused-of-shooting-area-boxer
Charges dismissed against suspect accused of shooting area boxer
chargesdismissedsuspectaccusedshooting
https://d1698.cms.socastsrm.com/2022/01/25/alec-baldwin-argues-that-civil-lawsuit-regarding-fatal-rust-shooting-should-be-dismissed/
Alec Baldwin Argues That Civil Lawsuit Regarding Fatal Rust Shooting Should Be Dismissed |...
Alec Baldwin and other producers of Rust filed a motion on Monday (January 24th) to dismiss a civil lawsuit brought forth by the movie's script supervisor,...
alec baldwincivil lawsuitarguesregardingfatal
https://theiowastandard.com/2020-higher-ed-isu-professor-warns-students-will-be-dismissed-if-they-disagree-with-her-on-gay-marriage-abortion-blm/
2020: HIGHER ED - ISU professor warns students will be dismissed if they disagree with her on gay...
Dec 24, 2020 - ***We are republishing our most popular stories from 2020. We hope you enjoy this look back! If you appreciate what The Iowa Standard does, please consider...
higher edisuprofessorwarnsstudents