https://www.hackster.io/news/ghostwrite-a-serious-flaw-in-the-t-head-xuantie-c910-and-c920-cores-hits-popular-risc-v-sbcs-14833c98e33d
GhostWrite, a Serious Flaw in the T-Head XuanTie C910 and C920 Cores, Hits Popular RISC-V SBCs -...
An issue in T-Head's implementation of the RISC-V vector extension renders all security null and void, researchers warn.
https://thehackernews.com/2026/07/new-wp2shell-wordpress-core-flaw-lets.html
New wp2shell WordPress Core Flaw Lets Unauthenticated Attackers Run Code
WordPress 6.9.5 and 7.0.2 patch wp2shell, a pre-auth core RCE that lets anonymous attackers run code on default installs, even with no plugins.
wordpress corenewflawletsattackers
https://play.google.com/store/apps/details?id=com.ticimax.androidbase.flawwears
FLAW - Apps on Google Play
Streetwear and Urban Culture are now in your pocket!
on googleflawappsplay
https://www.desisengroup.com/
Flaw Detector,Eddy current detector,Ultrasonic flaw detector-Suzhou desisen electronics co.,ltd
Suzhou desisen electronics co.,ltd is professional non-destructive testing equipment manufacturers, providing high-quality eddy current and ultrasonic flaw...
flaw detectoreddy currentultrasonicsuzhouelectronics
https://theflaw.org/
The Flaw - On Corporate Law and Power, Social Problems, and Systemic Injustices.
On Corporate Law and Power, Social Problems, and Systemic Injustices.
corporate lawsocial problemsflaw
https://cyberinsider.com/wordpress-releases-emergency-update-for-critical-wp2shell-rce-flaw/
WordPress releases emergency update for critical 'wp2shell' RCE flaw | CyberInsider
Jul 18, 2026 - WordPress released emergency security updates to fix wp2shell, that allows unauthenticated attackers to achieve RCE on vulnerable websites.
wordpress releasesemergencyupdatecriticalrce
https://thehackernews.com/2025/12/new-mongodb-flaw-lets-unauthenticated.html
New MongoDB Flaw Lets Unauthenticated Attackers Read Uninitialized Memory
High-severity CVE-2025-14847 allows unauthenticated attackers to read uninitialized heap memory in MongoDB due to a zlib compression handling flaw.
newmongodbflawletsattackers
https://thehackernews.com/2024/08/new-zero-day-flaw-in-apache-ofbiz-erp.html?version=meter+at+null
New Zero-Day Flaw in Apache OFBiz ERP Allows Remote Code Execution
Critical zero-day vulnerability in Apache OFBiz ERP system allows unauthorized remote code execution. Patch available for versions prior to 18.12.15.
zero dayapache ofbiz
https://www.tomshardware.com/news/microsoft-xbox-one-security-5-year-old,26471.html
Xbox One Security Flaw Uncovered by Five-Year-Old Boy | Tom's Hardware
Apr 7, 2014 - You have to wonder how this bug got past QA.
five year old
https://isteve.blogspot.com/2010/12/central-flaw-in-contemporary.html?showComment=1292537202154
Steve Sailer: iSteve: The Pointlessness of the Central Flaw in Current Thought
In the latest brouhaha over new Nixon tapes, I saw something in passing by Slate writer Jack Shafer that is illustrative of the most fundame...
steve sailerpointlessness
https://isteve.blogspot.com/2010/12/central-flaw-in-contemporary.html?showComment=1292489255140
Steve Sailer: iSteve: The Pointlessness of the Central Flaw in Current Thought
In the latest brouhaha over new Nixon tapes, I saw something in passing by Slate writer Jack Shafer that is illustrative of the most fundame...
steve sailerpointlessness
https://thehackernews.com/2026/05/critical-apache-http2-flaw-cve-2026.html
Critical Apache HTTP/2 Flaw (CVE-2026-23918) Enables DoS and Potential RCE
Apache fixes CVE-2026-23918 in HTTP/2; double-free flaw enables DoS and RCE, impacting version 2.4.66 users.
https://www.computerweekly.com/news/1280096272/Sourcefire-fixes-Snort-flaw
Sourcefire fixes Snort flaw | Computer Weekly
sourcefirefixessnortflawcomputer
https://isteve.blogspot.com/2010/12/central-flaw-in-contemporary.html?showComment=1292488114663
Steve Sailer: iSteve: The Pointlessness of the Central Flaw in Current Thought
In the latest brouhaha over new Nixon tapes, I saw something in passing by Slate writer Jack Shafer that is illustrative of the most fundame...
steve sailerpointlessness
https://popularrationalism.substack.com/p/peer-reviewed-study-confirms-fatal/comments
Comments - Peer-Reviewed Study Confirms Fatal Flaw in PCR Testing: 42% False Discovery Rate for...
All COVID-19 Vaccine Studies Used nonQ-RT-PCR to determine case status. All of the estimates of outcome are unreliable. This is the most important study we...
https://nrc-publications.canada.ca/eng/view/object/?id=d248d617-ee7a-4f68-b094-68798edf4a5a
Sensitive flaw detector solves noise problems - NRC Publications Archive - Canada.ca
Sensitive flaw detector solves noise problems
flaw detectorpublications archivesensitivesolvesnoise
https://thehackernews.com/2021/08/critical-cosmos-database-flaw-affected.html
Critical Cosmos Database Flaw Affected Thousands of Microsoft Azure Customers
Microsoft Azure Cosmos DB had a critical data leak that affected thousands of organizations
thousands ofmicrosoft azurecriticalcosmosdatabase
https://thehackernews.com/2024/01/chinese-hackers-silently-weaponized.html
Chinese Hackers Silently Weaponized VMware Zero-Day Flaw for 2 Years
A China-linked cyber espionage group called UNC3886 has been exploiting a zero-day vulnerability in VMware vCenter Server (CVE-2023-34048).
chinese hackerszero daysilentlyweaponizedvmware
https://thehackernews.com/2024/08/github-patches-critical-security-flaw.html
GitHub Patches Critical Security Flaw in Enterprise Server Granting Admin Privileges
GitHub patches critical Enterprise Server vulnerabilities, including SAML SSO exploit. Update now to prevent unauthorized admin access and data breach
enterprise servergithubpatchescriticalsecurity
https://www.tomsguide.com/computing/online-security/millions-at-risk-due-to-severe-security-flaw-in-license-plate-readers
Millions at risk due to severe security flaw in license plate readers | Tom's Guide
Jan 10, 2025 - More than 150 misconfigured Motorola license plate readers are leaking video feeds and data in real-time.
https://advisories.gitlab.com/pypi/ansible-core/CVE-2024-0690/
Ansible-core information disclosure flaw | GitLab Advisory Database (GLAD)
CVE-2024-0690 Ansible-core information disclosure flaw: An information disclosure flaw was found in ansible-core due to a failure to respect the ANSIBLE_NO_LOG...
core informationansibledisclosureflawgitlab
https://blog.hubspot.com/sales/live-chat-go-to-market-flaw?__hstc=251908822.88349152453906cc4b27ad783c1de154.1703581096350.1706455339878.1706514924593.25&__hssc=251908822.4.1706514924593&__hsfp=4111276061
Live Chat Exposes a Fatal Flaw in Your Go-to-Market
Today, buyer patience is at an all-time low. Speed is more important than ever. Many marketers and salespeople are turning to live chat -- which has long been...
live chatfatal flawgo toexposes
https://us.community.samsung.com/t5/Discussions/The-main-flaw-of-One-UI-6/m-p/2697852/highlight/true
Re: Re: Re: The main flaw of One UI 6 - Samsung Community - 2697386
Oct 23, 2023 - Yes, I hold my phone with a hand behind it. Since I'm left handed, the right holds the phone. Only took it this way to grab an image of it. - 2697386
the mainone uisamsung communityflaw
https://www.ibm.com/support/pages/node/7017974?myns=swgother&mynp=OCSWG60&mynp=OCSSC5L9&mynp=OCSS9QQS&mynp=OCSSTS2D&mynp=OCSSB23CE&mync=E&cm_sp=swgother-_-OCSWG60-OCSSC5L9-OCSS9QQS-OCSSTS2D-OCSSB23CE-_-E
Security Bulletin: ISC BIND on IBM i is vulnerable to denial of service due to a memory usage flaw...
Domain Name System (DNS) uses ISC BIND. ISC BIND on IBM i is vulnerable to a denial of service attack due to memory usage exceeding the configured cache size...
https://forums.windowscentral.com/threads/new-android-security-flaw.286003/
New Android Security Flaw. | Windows Central Forum
And I wasn't even looking.
new androidwindows centralsecurityflawforum
https://www.newstatesman.com/long-reads/2014/08/diy-diagnosis-how-extreme-athlete-uncovered-her-genetic-flaw
DIY diagnosis: how an extreme athlete uncovered her genetic flaw
Oct 4, 2023 - Kim Goodsell was running along a mountain trail when her left ankle began turning inward, unbidden. A few weeks later she started having trouble lifting her...
diydiagnosisextremeathleteuncovered
https://novotest.biz/
Quality control devices - flaw detectors, hardness testers | Novotest
Dec 12, 2025 - NOVOTEST is a company that produces various testing equipment. We provide instruments for metal hardness testing, coatings thickness, and ultrasonic inspection.
quality control devicesflaw detectorshardness testersnovotest
https://www.tomshardware.com/news/macbook-apple-RAM-4GB-firmware,6679.html
MacBook Firmware Released, RAM Flaw Still Present | Tom's Hardware
Dec 11, 2008 - A new firmware update hits MacBooks, but issues still remain.
still presentmacbookfirmwarereleasedram
https://ecuadorjoannansilmin.blogspot.com/2014/07/one-flaw-in-women-by-paul-jenkins.html
Ecuador Joannan silmin - Ecuador in my eyes: One Flaw in Women by Paul Jenkins
One Flaw in Women Women have strengths that amaze men. They bear hardships and they carry burdens, but they hold happiness, lov...
in my eyes
https://thehackernews.com/2024/12/apache-mina-cve-2024-52046-cvss-100.html?version=meter+at+null
Apache MINA CVE-2024-52046: CVSS 10.0 Flaw Enables RCE via Unsafe Serialization
Critical Apache MINA flaw CVE-2024-52046 with CVSS 10.0 enables RCE via serialization flaws. Patch required.
https://www.digitaljournal.com/business/chinas-xiaomi-to-remotely-fix-assisted-driving-flaw-in-110000-su7-cars/article
China's Xiaomi to remotely fix assisted driving flaw in 110,000 SU7 cars - Digital Journal
Sep 19, 2025 - Chinese consumer tech giant Xiaomi will remotely fix a flaw in the assisted driving system on over 110,000 of its popular SU7 electric cars, the firm and
https://thehackernews.com/2025/08/freepbx-servers-targeted-by-zero-day.html?m=0
FreePBX Servers Targeted by Zero-Day Flaw, Emergency Patch Now Available
Active FreePBX zero-day (CVE-2025-57819) + CVSS 10.0 exploited since Aug 21, 2025 + enables unauthenticated admin access and RCE.
zero dayfreepbxserverstargeted
https://lists.cs.princeton.edu/hyperkitty/list/chuck-dev@lists.cs.princeton.edu/message/3ZGO3OIWAKST3K5RHOOBJ4JTLKRYEH62/
[chuck-dev] osc bug & example flaw - chuck-dev - lists.cs.princeton.edu
chuckdevoscbugexample
https://thehackernews.com/2025/09/microsoft-patches-critical-entra-id.html?m=1
Microsoft Patches Critical Entra ID Flaw Enabling Global Admin Impersonation Across Tenants
Microsoft patched CVE-2025-55241 July 17, 2025; CVSS 10.0 Entra ID bug via legacy Graph enabled cross-tenant impersonation risking tenant compromise.
entra id
https://www.techradar.com/pro/security/sonicwall-vpn-flaw-could-allow-hackers-to-hijack-your-sessions-so-patch-now
SonicWall VPN flaw could allow hackers to hijack your sessions, so patch now | TechRadar
Feb 12, 2025 - A PoC for recent SonicWall flaw has been released
https://lanzadiscalea.ucsd.edu/research/rail/rail-flaw-imaging
Rail Flaw Imaging
Transverse Fissure in rail
railflawimaging
https://www.androidauthority.com/samsung-fix-secure-folder-flaw-3577852/
Samsung fixes the Secure Folder flaw that let anyone see what apps you're hiding - Android Authority
Jul 15, 2025 - Samsung has fixed an issue with the Secure Folder that let anyone with access to your Galaxy see your hidden apps and photos.
https://isteve.blogspot.com/2010/12/central-flaw-in-contemporary.html
Steve Sailer: iSteve: The Pointlessness of the Central Flaw in Current Thought
In the latest brouhaha over new Nixon tapes, I saw something in passing by Slate writer Jack Shafer that is illustrative of the most fundame...
steve sailerpointlessness
https://www.arabnews.com/node/1444386/media
Apple thanks Saudi for detecting security flaw | Arab News
Jan 30, 2019 - JEDDAH: Fatima Al-Harbi has attracted Saudi and global attention for discovering a security flaw in the most powerful security systems of Apple, Microsoft and...
applethankssaudidetectingsecurity
https://saberpoint.blogspot.com/2011/04/major-flaw-in-american-democracy.html?showComment=1303189242880
Saberpoint: The Major Flaw in American Democracy
politics, popular culture, American history
the majorflawamericandemocracy
https://chinacoalgroup.en.made-in-china.com/product/FxHrevnJOQRO/China-Light-Track-Inspection-Vehicle-Railway-Track-Safety-Flaw-Detection-Vehicle-Transfer-Cart.html
Light Track Inspection Vehicle Railway Track Safety Flaw Detection Vehicle Transfer Cart - Rail...
Light Track Inspection Vehicle Railway Track Safety Flaw Detection Vehicle Transfer Cart, Find Details and Price about Rail Inspection Vehicle Rail Inspection...
track inspectionrailway safetyflaw detectiontransfer cartlight
https://www.ibtimes.co.uk/heartbleed-bug-everything-you-need-know-about-openssl-security-flaw-1443991
Heartbleed Bug: Everything You Need to Know About OpenSSL Security Flaw | IBTimes UK
Apr 11, 2014 - Complete guide to what Heartbleed bug is, who is affected, how to fix it and should you be worried.
everything you need to know
https://cyeeyotest.en.made-in-china.com/product/nQfRHGNoFVpJ/China-Competitive-Price-Ultrasonic-Flaw-Detector-Testing-Machine.html
Competitive Price Ultrasonic Flaw Detector Testing Machine - Flaw Detector and Ut Flaw Detector
Competitive Price Ultrasonic Flaw Detector Testing Machine, Find Details and Price about Flaw Detector Ut Flaw Detector from Competitive Price Ultrasonic Flaw...
ultrasonic flaw detectorcompetitive pricetesting machineut
https://chenjibusiness.en.made-in-china.com/product-group/eqmaGMNBhHRi/Flaw-detector-non-destructive-tester-catalog-1.html
Flaw detector/non-destructive tester - Jinan Chenji International Trade Co., Ltd. - page 1.
China Flaw detector/non-destructive tester catalog of Full-Digital Portable Eddy Current Metal Crack Flaw Detector, Nonmetal Ultrasonic Apparatus for Concrete...
https://raconteurreport.blogspot.com/2018/10/spot-flaw-in-your-response.html
Raconteur Report: Spot The Flaw In Your Response
Common sense is bouncing off the adamantine armor of some people's bulletproof heads, so I'll try pictures instead: Watch how a Leftard re...
raconteur reportspotflawresponse
https://www.computerweekly.com/news/450403896/Mozilla-and-Tor-issue-patches-for-Firefox-flaw-exposing-Tor-users
Mozilla and Tor issue patches for Firefox flaw exposing Tor users | Computer Weekly
Users of Tor anonymous browsing urged to update to the latest versions of relevant software to block an exploit that collects IP and MAC addresses to identify...
for firefox
https://community.f5.com/kb/security-insights/oracle-hack-north-korean-hackers-critical-flaw-in-apache/340708
Oracle hack, North Korean Hackers, Critical Flaw in Apache | DevCentral
Apr 8, 2025 - This week in cybersecurity, it seems both hackers and defenders have been working overtime, While hackers have been creatively causing chaos,...
north korean hackersoraclecriticalflawapache
https://www.pymnts.com/news/security-and-risk/2021/mcafee-peloton-bike-security-flaw-could-let-hackers-spy-on-riders/
McAfee: Peloton Flaw Could Let Hackers Spy
mcafeepelotonflawcouldlet
https://repository.lib.ncsu.edu/items/95a33664-51cc-435d-97f5-9e0e451fe9da
SAFETY ASSESSMENT OF K-11 PRESSURE TUBE OF KAIGA-2 REACTOR FOR THE OBSERVED FLAW DURING ISI-2010
https://html5-player.libsyn.com/embed/episode/id/27717651/height/75/theme/legacy/thumbnail/yes/direction/backward/stats-code/MKR/
GS 207 - The Engineering Flaw In Most Marketing Campaigns
gsengineeringflawmarketingcampaigns
https://www.pcgamer.com/nearly-80-netgear-routers-have-a-major-security-flaw-and-half-wont-be-patched/
Nearly 80 Netgear routers have a major security flaw and half won't be patched | PC Gamer
Jul 31, 2020 - If you own one of the 45 affected models, you should upgrade.
https://www.pymnts.com/news/security-and-risk/2018/lifelock-security-flaw-data-breach-symantec/
LifeLock Website Offline Due to Security Flaw
due tolifelockofflinesecurityflaw
https://thehackernews.com/2024/01/urgent-upgrade-gitlab-critical.html
URGENT: Upgrade GitLab - Critical Workspace Creation Flaw Allows File Overwrite
Hackers could write ANY file on your GitLab server while creating a workspace. This critical flaw (CVE-2024-0402) affects all versions.
urgentupgradegitlabcriticalworkspace
https://www.techradar.com/news/a-new-microsoft-exchange-flaw-is-being-used-to-attack-servers
A new Microsoft Exchange flaw is being used to attack servers | TechRadar
Dec 21, 2022 - Attackers are delivering remote access software
a newmicrosoft exchange
https://www.windowscentral.com/cumulative-update-fixes-bug-left-systems-vulnerable-wormable-attack
Microsoft promptly patched this week's 'wormable' Windows 10 flaw | Windows Central
Mar 12, 2020 - Microsoft sent out a cumulative update recently that fixes a wormable vulnerability. Details of the vulnerability recently leaked online ahead of Patch Tuesday.
this weekmicrosoftpromptlypatched
https://advisories.gitlab.com/npm/@gitlawb/openclaude/CVE-2026-35570/
OpenClaude: Sandbox Bypass via Early-Exit Logic Flaw Allows Path Traversal | GitLab Advisory...
CVE-2026-35570 OpenClaude: Sandbox Bypass via Early-Exit Logic Flaw Allows Path Traversal : A logic flaw exists in bashToolHasPermission() inside...
https://pbokelly.blogspot.com/2019/05/meltdown-redux-intel-flaw-lets-hackers.html
Peter O'Kelly's Reality Check: Meltdown Redux: Intel Flaw Lets Hackers Siphon Secrets from Millions...
Also see Apple, Amazon, Google, Microsoft and Mozilla release patches for ZombieLoad chip flaws | TechCrunch "Intel had asked all the res...
https://ncmountainwoman.blogspot.com/2012/07/mend-thine-every-flaw.html?showComment=1341456495397
MOUNTAIN MUSINGS: Mend Thine Every Flaw
America! America! God mend thine ev'ry flaw Confirm thy soul in self-control Thy liberty in law ! (Katharine Lee Bates...
mountainmusingsmendthineevery
https://thehackernews.com/2023/07/alert-330000-fortigate-firewalls-still.html
Alert: 330,000 FortiGate Firewalls Still Unpatched to CVE-2023-27997 RCE Flaw
Over 330,000 FortiGate firewalls are still vulnerable to the critical CVE-2023-27997 RCE exploit.
https://thehackernews.com/2024/12/fortinet-warns-of-critical-fortiwlm.html
Fortinet Warns of Critical FortiWLM Flaw That Could Lead to Admin Access Exploits
Fortinet patches critical flaws in FortiWLM and FortiManager. CVE-2023-34990 risks sensitive data, while CVE-2024-48889 enables command injection.
https://aokcompat.blogspot.com/2013/09/microsoft-zero-day-ie-flaw-with-complex.html
Application Management in the 21st Century: Microsoft Zero-Day IE flaw with a complex fix
I would have normally waited until my monthly Patch Tuesday update to discuss Microsoft security vulnerabilities and updates. However, wh...
https://thehackernews.com/2014/06/disqus-wordpress-plugin-flaw-leaves.html
Disqus Wordpress Plugin Flaw Leaves Millions of Blogs Vulnerable to Hackers
A critical Remote code execution (RCE) vulnerability in Disqus Wordpress Plugin Leaves Millions of Wordpress Blogs Vulnerable to Hackers.
wordpress plugindisqusflawleaves
https://www.tableau.com/nl-nl/blog/notification-about-flaw-tableau-public-disable-download-feature
Notification About a Flaw in the Tableau Public 'Disable Download' Feature
about ain thetableau publicnotificationflaw
https://securityweeklytv.libsyn.com/podcast/m1-chip-flaw-boeing-747-hacking-don-t-blame-the-intern-john-deere-psw-696
Security Weekly Podcast Network (Video): M1 Chip Flaw, Boeing 747 Hacking, Don't Blame the Intern,...
This week in the Security Weekly News, Paul and the Crew Talk: Nagios exploits, hacking a Boeing 747, bypass container image scanning, unpatchable new...
https://www.cbsnews.com/pittsburgh/news/kidde-smoke-detector-recall/
Kidde Recalling Thousands Of Smoke Detectors Over Manufacturing Flaw - CBS Pittsburgh
Hundreds of thousands of smoke detectors are being recalled over a flaw that could keep them from working properly.
thousands ofsmoke detectorskidderecalling
https://pure.psu.edu/en/publications/pipeline-flaw-detection-using-shear-emat-and-wavelet-analysis/
Pipeline flaw detection using shear EMAT and wavelet analysis - Penn State
flaw detectionpipelineusingshear
https://www.techradar.com/pro/security/okta-fixes-a-rather-embarrassing-but-very-serious-password-flaw
Okta fixes a rather embarrassing, but very serious, password flaw | TechRadar
Nov 4, 2024 - For some usernames, a password was not necessary
oktafixesratherembarrassing
https://thehackernews.com/2011/11/researcher-charlie-miller-kicked-out.html
Researcher Charlie Miller kicked out from iOS dev program for Exploiting iOS security flaw
Researcher Charlie Miller kicked out from iOS dev program for Exploiting iOS security flaw | Read more hacking news on The Hacker News cybersecurity news...
https://thehackernews.com/2024/02/fortinet-warns-of-critical-fortios-ssl.html?version=meter+at+null
Fortinet Warns of Critical FortiOS SSL VPN Flaw Likely Under Active Exploitation
Fortinet has unveiled a critical security flaw in its SSL VPN, CVE-2024-21762, allowing hackers to execute arbitrary code.
ssl vpn
https://www.tomshardware.com/news/intel-security-flaw-atom-pentium-celeron
Intel Low-power Chips Hit by New Security Flaw | Tom's Hardware
Nov 16, 2021 - Debug mode has 'excessive privileges'
low power
https://newrepublic.com/article/79136/the-debt-commissions-gaping-flaw
The Debt Commission's Gaping Flaw | The New Republic
May 11, 2021 - Stan Collender identifies the biggest hole in the center of the debt commission's plan -- it wrenches billions of dollars out of the domestic discretionary...
the debtcommissiongapingflawnew
https://www.tomshardware.com/news/cortana-browser-lock-screen-bypass,37621.html
Cortana Flaw Gave Hackers Web Access on Locked Windows 10 Devices | Tom's Hardware
Aug 16, 2018 - Researchers found even more Cortana flaws attackers could exploit to bypass the Windows 10 lock screen.
https://www.techtarget.com/searchsecurity/answer/How-can-a-NULL-pointer-dereference-flaw-create-a-DoS-attack
How can a NULL pointer dereference flaw create a DoS attack? | TechTarget
A NULL pointer dereference vulnerability was found in the libpng graphics library. Find out how the flaw managed to escape notice for years.
how cannull pointerdos attack
https://thehackernews.com/expert-insights/2024/05/github-abuse-flaw-shows-why-we-cant.html
GitHub Abuse Flaw Shows Why We Can't Shrug Off Abuse Vulnerabilities in Security
Explore how GitHub's mention mechanism can be manipulated by threat actors to send phishing emails bypassing traditional security
https://www.techradar.com/news/cisco-routers-have-major-security-flaw
Cisco routers have major security flaw | TechRadar
Sep 26, 2019 - Security advisory discloses 13 vulnerabilities
cisco routersmajorsecurityflawtechradar
https://www.windowscentral.com/software-apps/new-winrar-zero-day-pc-vulnerability-exploited-by-hackers-what-you-need-to-know
CVE-2025-8088: The WinRAR Flaw Hackers Are Exploiting Right Now | Windows Central
Aug 12, 2025 - This zero-day lets attackers run malicious code on your PC. Translation: they could take control.
https://op.europa.eu/en/web/public-procurement/procurement-details/-/procurement/0c491475-0b09-463d-a15b-8dfeafe5926e
Purchase of a Combined Track Flaw Detection Vehicle - EU tenders - Publications Office of the EU
https://india.entrepreneur.com/growth-strategies/the-fundamental-flaw-in-all-indian-startups/280599
The Fundamental Flaw in all Indian startups
Oct 4, 2025 - Why has this not been worked out till now by virtually all Indian startups?
the fundamentalall indianflawstartups
https://futurism.com/the-byte/smart-pet-feeders-hackers-overfeed-cat
Flaw in Smart Pet Feeders Lets Hackers Overfeed Your Cat
A Russian security researcher claims to have accidentally identified some troubling vulnerabilities in the firmware of Xiaomi FurryTail smart pet feeders.
smart pet feedersflawletshackerscat
https://drybonesblog.blogspot.com/2014/05/the-american-flaw.html
the American Flaw - the Dry Bones Blog
the americandry bonesflawblog
https://daringfireball.net/linked/2018/04/25/nintendo-switch-hack
Daring Fireball: Nvidia Tegra Flaw Allows Nintendo Switch to Be Jailbroken
Link to: https://www.theverge.com/2018/4/24/17276214/nintendo-switch-hack-jailbreak-security-homebrew-apps-games
daring fireballnvidia tegranintendo switchto beflaw
https://futurium.ec.europa.eu/bg/apply-ai-alliance/community-content/smoothing-inconsistencies-most-dangerous-structural-flaw-critical-ai
Smoothing Inconsistencies : The most dangerous structural flaw of critical AI | Futurium
The primary risk of modern AI applied to critical systems is not spectacular hallucinations.It is a far more discreet and therefore more dangerous mechanism:...
the mostcritical aismoothinginconsistenciesdangerous
https://www.tomshardware.com/news/intel-disables-directx-12-on-haswell
Intel Disables DirectX 12 for Some CPUs Due to Security Flaw | Tom's Hardware
Nov 5, 2021 - Potential security vulnerability makes Intel disable DirectX 12 on 4th Gen Core PCs.
https://appleinsider.com/articles/19/08/07/new-spectre-style-intel-chip-flaw-can-leak-user-data-but-only-in-windows
New Spectre-style Intel chip flaw can leak user data, but only in Windows | AppleInsider
PC users and those who are running Windows on a Mac may want to take a moment to update their operating systems, as a new flaw in Intel and ARM chips has been...
https://www.tomshardware.com/news/macos-flaw-full-system-compromise,36205.html
MacOS Kernel Flaw Could Allow Full-System Compromise | Tom's Hardware
Jan 2, 2018 - A hobbyist security researcher published a macOS kernel vulnerability in the last day of the year. The researcher didn't notify Apple ahead of time about the...
full systemmacoskernelflawcould
https://alexschadenberg.blogspot.com/2025/02/false-diagnosis-exposes-key-flaw-with.html?m=0
Euthanasia Prevention Coalition Euthanasia Prevention Coalition: Misdiagnosis exposes a key flaw...
A blog about euthanasia, assisted suicide, elder abuse, end-of-life care, disability rights, palliative care.
prevention coalitioneuthanasiamisdiagnosisexposeskey
https://www.macrumors.com/2019/03/04/google-details-macos-kernel-flaw/
Google Shares Details on Unpatched 'High Severity' macOS Kernel Flaw - MacRumors
Google's Project Zero team in November found a "high severity" macOS kernel flaw that was recently disclosed (via Neowin) following the expiration of a 90 day...
google sharesdetails
https://www.techradar.com/news/even-the-ingenuity-mars-helicopter-is-vulnerable-to-log4j
NASA confirms Ingenuity not vulnerable to log4j flaw | TechRadar
Dec 20, 2021 - The flawed logger does not power the most remote helicopter ever built, NASA says
nasaconfirmsingenuityvulnerableflaw
https://www.techradar.com/pro/security/proofpoint-email-filter-flaw-exploited-to-send-out-millions-of-phishing-messages
Proofpoint email filter flaw exploited to send out millions of phishing messages | TechRadar
Jul 30, 2024 - Phishing emails "perfectly" spoofed likes of Disney, Nike and more
https://www.ibtimes.co.uk/equifax-blames-months-old-web-server-flaw-massive-data-breach-that-affected-143-million-people-1639302
Equifax blames months-old web server flaw for massive data breach that affected 143 million people...
Sep 14, 2017 - The massive hack is one of the largest in US history and the biggest known leak this year so far.
https://thehackernews.com/2024/05/critical-tinyproxy-flaw-opens-over.html
Critical Tinyproxy Flaw Opens Over 50,000 Hosts to Remote Code Execution
Critical unpatched flaw (CVE-2023-49606) in Tinyproxy could lead to remote code execution. Over 50% of 90K+ exposed hosts are vulnerable.
https://www.macrumors.com/2022/08/19/update-apple-devices-safari-security-flaw/
PSA: Safari Security Flaw 'Actively Exploited,' Update Your Apple Devices Now - MacRumors
This week, Apple released critical software updates for Safari which fix a security flaw that exists in the browser across iPhone, iPad, and Mac platforms....
https://thehackernews.com/2010/12/microsoft-warnings-about-flaw-inviting.html
Microsoft Warns of Serious Flaw in Internet Explorer
Microsoft warns of a critical Internet Explorer flaw allowing hackers to control unprotected computers. Users of IE 6 to 8 are at risk.
microsoftwarnsseriousflawinternet
https://www.redhat.com/en/blog/understanding-critical-kubernetes-privilege-escalation-flaw-openshift-3
Understanding the critical Kubernetes privilege escalation flaw in OpenShift 3
A critical security vulnerability in Kubernetes (CVE-2018-1002105) affecting OpenShift Container Platform 3 was patched by Red Hat in December 2018. The...
privilege escalationunderstandingcriticalkubernetesflaw
https://community.atlassian.com/forums/Sourcetree-questions/Flaw-quot-Access-denied-quot-timeout-very-long/qaq-p/845728
Flaw: "Access denied" timeout very long
Aug 14, 2018 - I triggered a pull command and wondered why it took so long. Checking "Shows Full Output" revealed a stream of "Access denied"
access deniedflawtimeoutlong
https://thehackernews.com/2022/04/rarible-nft-marketplace-flaw-couldve.html?m=1
Rarible NFT Marketplace Flaw Could've Let Attackers Hijack Crypto Wallets
A new vulnerability within the Rarible NFT Marketplace could have allowed attackers to take over cryptocurrency wallets.
rarible nftmarketplaceflawcould
https://pure.psu.edu/en/publications/toward-in-situ-flaw-detection-in-laser-powder-bed-fusion-additive/
Toward in-situ flaw detection in laser powder bed fusion additive manufacturing through layerwise...
laser powder bed fusion
https://thehackernews.com/2025/05/vicioustrap-uses-cisco-flaw-to-build.html
ViciousTrap Uses Cisco Flaw to Build Global Honeypot from 5,300 Compromised Devices
ViciousTrap exploited CVE-2023-20118 to hijack 5,300 routers, building a honeypot-style spy network.
https://sexxxstart.com/elizabeth-smith/
Elizabeth Smith – Being bad at texting back is my only flaw. Probably – Start with Sex – Webcam...
https://thehackernews.com/2020/01/warning-quickly-patch-new-critical.html?m=1
Update Windows 10 Immediately to Patch a Flaw Discovered by the NSA
Microsoft Releases Patch for Critical Windows CryptoAPI Spoofing Flaw (CVE-2020-0601) Discovered by the NSA.