https://frackingforpresident.com/
Fracking for President at Frackingforpresident.com
Frackingforpresident.com is offered. Inquire to acquire this unique .com domain name.
frackingpresident
https://drillordrop.com/
DRILL OR DROP? – 10+ years of independent journalism on UK fracking, onshore oil and gas and the...
10+ years of independent journalism on UK fracking, onshore oil and gas and the reactions to it
https://www.ecowatch.com/monterey-ban-fracking-california-2086759695.html
Monterey Becomes California's First Major Oil-Producing County to Ban Fracking - EcoWatch
Oct 4, 2021 - Voters in Monterey County passed Measure Z to ban fracking and other dangerous extraction techniques. While oil companies have fracked in Monterey County
https://irjci.blogspot.com/2016/12/language-in-controversial-epa-study-on.html
The Rural Blog: Language in controversial EPA study on fracking was tempered after White House...
Language in a controversial 2015 Environmental Protection Agency study on horizontal hydraulic fracturing was added after a meeting with ...
https://unearthed.greenpeace.org/2016/02/08/us-fracking-is-having-troubles/
US fracking stalls as drillers head for bankruptcy
Jul 29, 2018 - US fracking has been pushed brink of bankruptcy by the low oil price, according to new data from energy analysts at Haynes and Boone.
usfrackingstallsdrillershead
https://uwaterloo.ca/news/media/new-map-shows-where-fracking-induced-earthquakes-could-hit
New map shows where fracking-induced earthquakes could hit in Canada | Waterloo News | University...
Aug 13, 2022 - Scientists from the University of Waterloo have developed a map showing which regions and population centres of Western Canada are likely to experience...
https://www.commondreams.org/newswire/2014/11/05/community-organizing-wins-significant-victories-fracking-and-other-key-issues
Community organizing triumphs on fracking & more. | Common Dreams
community organizingtriumphsfrackingcommondreams
https://senatedemocrats.wa.gov/salomon/2019/05/08/governor-signs-prohibition-on-fracking-in-washington/
Governor signs prohibition on fracking in Washington - Sen. Jesse Salomon
Sep 15, 2020 - Putting People First
in washingtongovernorsignsprohibitionfracking
https://www.salon.com/topic/fracking-bans
Fracking Bans Archives - Salon.com
frackingbansarchivessalon
https://southof5and20.blogspot.com/2011/07/dryden-residents-support-fracking.html
South of 5 and 20: Dryden residents support fracking
The Town of Dryden, NY, a rural township evolving into a bedroom suburb for Cornell University, held a big anti-fracking hoedown last night...
southdrydenresidentssupportfracking
https://www.cbsnews.com/pittsburgh/news/penn-township-frackng-protest/
Environmental Group Protests Proposed Fracking Project In Penn Township - CBS Pittsburgh
Members of Protect Penn Trafford rallied outside of the Pa. Department of Environment Protection office to voice their opposition to a fracking site.
environmental groupproject inpenn townshipprotestsproposed
https://northstoke.blogspot.com/2017/12/farmers-against-fracking.html
North Stoke: Farmers against Fracking
north stokefarmersfracking
https://www.aljazeera.com/video/techknow/2015/12/6/does-fracking-cause-earthquakes
Does fracking cause earthquakes? | Science and Technology | Al Jazeera
We go to Texas to explore the relationship between fracking and earthquakes.
science and technologyfrackingcauseearthquakesal
https://peterblack.blogspot.com/2022/09/fracking-hell.html?m=0
Peter Black: Fracking hell
peter blackfrackinghell
https://wiki.ubc.ca/Course:CONS200/Hydraulic_fracturing_(fracking):_social_and_environmental_costs_in_Alberta
Course:CONS200/Hydraulic fracturing (fracking): social and environmental costs in Alberta - UBC Wiki
https://www.commondreams.org/newswire/2020/12/16/gina-mccarthys-fracking-history-odds-new-climate-position
Gina McCarthy's Fracking History at Odds With New Climate Position | Common Dreams
Dec 16, 2020 - During her previous tenure at EPA, McCarthy boosted fracking while downplaying clear risks.
https://www.commondreams.org/news/2015/02/24/fracking-friendly-ohio-justices-backed-oil-and-gas-industry-analysis-shows
Fracking-Friendly Ohio Justices Backed by Oil and Gas Industry, Analysis Shows | Common Dreams
Jul 18, 2024 - Number-crunching backs up judge's dissenting opinion: 'What the drilling industry has bought and paid for in campaign contributions they shall receive.'
oil and gas industry
https://hubpages.com/politics/The-continued-assault-on-the-process-of-fracking-to-access-our-energy-reserves
The continued assault on the process of fracking to access our energy reserves | HubPages
The process of fracking has been and is a controversial process for accessing our energy resources but it has been proven to be acceptable through evidence. It...
https://johnhanger.blogspot.com/2011/04/china-starts-fracking-shale-gas-to.html
John Hanger's Facts of The Day: China Starts Fracking Shale Gas To Decrease Coal Use.
This week, China used hydraulic fracturing to complete its first horizontal shale gas well and began its journey to get 10% of its energy ne...
https://www.commondreams.org/newswire/2013/09/19/new-report-fracking-pollution-sickening-residents-tx-regulators-walk-away
Report: TX Residents Sick from Fracking Pollution, Regulators Ignoring | Common Dreams
Dec 22, 2022 - New Report from Earthworks Reveals Texas Case is Part of Emerging National Pattern: Regulators Actively Ignoring Evidence of Public Harm from Fracking...
reporttxresidentssick
https://www.democracynow.org/2016/6/10/can_bernie_sanders_help_rewrite_democratic
Can Bernie Sanders Help Rewrite Democratic Platform to Ban Fracking & Keep Oil in the Soil? |...
As the Democratic platform committee meets in Washington, we speak to Michelle Chan, spokesperson for Friends of the Earth Action. She is working on...
https://www.wri.org/insights/nearly-half-us-fracking-sites-overlap-water-stressed-regions
Nearly Half of U.S. Fracking Sites Overlap with Water-Stressed Regions | World Resources Institute
A new report from CERES draws a connection between water risk and hydraulic fracturing in the United States. The report adds an important dimension to the...
https://www.nber.org/papers/w21359
Who Needs a Fracking Education? The Educational Response to Low-Skill Biased Technological Change |...
Founded in 1920, the NBER is a private, non-profit, non-partisan organization dedicated to conducting economic research and to disseminating research findings...
https://smallestminority.blogspot.com/2013/01/quote-of-day-fracking-edition.html
The Smallest Minority: Quote of the Day - Fracking Edition
From Dale at Mostly Cajun : I worked for a company refurbishing a SONATRACH liquifaction plant that took that gas and liquified it and so...
the smallest minorityquotedayfrackingedition
https://www.sciencedaily.com/releases/2010/10/101025172926.htm
Uranium in groundwater? 'Fracking' mobilizes uranium in marcellus shale | ScienceDaily
Researchers have found that hydraulic fracturing or "fracking" -- causes uranium that is naturally trapped inside Marcellus shale to be released, raising...
marcellus shaleuraniumgroundwaterfrackingsciencedaily
https://www.ibtimes.co.uk/india-opens-shale-gas-exploration-coal-fracking-509161
India Opens Up Shale Gas Exploration Fracking With Coal Auction Policy Approval | IBTimes UK
Oct 2, 2013 - The Indian government opens up shale gas exploration and clears the way for allocating coal fields through auctions.
https://www.ub.edu/ubtv/taxonomy/term/21083
fracking | UBtv
fracking
https://legalruralism.blogspot.com/2012/10/fracking-photographed.html
Legal Ruralism: Fracking, photographed
The New York Times ran this multimedia feature a few days ago.
legalruralismfrackingphotographed
https://www.digitaljournal.com/topic/fracking/page/4
Fracking Archives - Page 4 of 4 - Digital Journal
The journal of record for the decisions that define how Canadian organizations lead in an innovation economy. Online since 1998.
archives pagefrackingdigitaljournal
https://brane-space.blogspot.com/2015/02/another-train-explosion-another-reason.html
Brane Space: Another Train Explosion - Another Reason To Stop Fracking!
The scenes emanating from Fayette Co., West Virginia resembled iconic images of Dante's Inferno as portrayed in several works of art. Gian...
branespaceanothertrainexplosion
https://fore.yale.edu/news/Fracking-Comes-Jewish-Summer-Camp?page=15
Fracking Comes to Jewish Summer Camp | Yale Forum on Religion and Ecology
jewish summer camp
https://news.fsu.edu/experts-categories/fracking/
Fracking - Florida State University News
florida state universityfrackingnews
https://unearthed.greenpeace.org/2015/06/28/new-adviser-to-amber-rudd-took-cash-from-fracking-lobbyists/
Adviser to Energy Secretary took cash from fracking lobby
Aug 29, 2017 - The new adviser to Amber Rudd, the energy and climate change secretary, has accepted a donation from a company that expects to benefit from fracking in...
adviserenergysecretarytookcash
https://www.birmingham.ac.uk/news-archive/2013/the-conversation-fracking-earthquakes-and-flaming-water-but-not-in-the-uk
The Conversation: Fracking earthquakes and flaming water: but not in the UK - University of...
Alan Herbert, Senior Lecturer in Radioactive Waste Disposal and Remediation, has written an article for The Conversation titled Fracking earthquakes and...
https://commonreader.wustl.edu/tag/the-fight-over-fracking/
the Fight over Fracking Archives - Common Reader
A journal of the essay
the fightfrackingarchivescommonreader
https://unearthed.greenpeace.org/2018/02/10/uk-shale-gas-fracking-report-forecast/
Confidential UK government report lowers fracking expectations
Jun 22, 2022 - The British government does not expect a fracking boom on the scale predicted by the shale gas industry, according to a confidential Cabinet Office report seen...
uk governmentconfidentialreportlowersfracking
https://southof5and20.blogspot.com/2011/10/for-fracking-before-he-was-against-it.html
South of 5 and 20: For fracking before he was against it
RFK, Jr.'s modest Westchester cottage Unlikely Hospitalist is calling for Robert F. Kennedy, Jr. to be kicked off New York governor And...
https://unearthed.greenpeace.org/2015/08/20/will-fracking-be-allowed-in-hundreds-of-sssis-and-around-several-protected-areas-and-beauty-spots/
UPDATE: Will fracking be allowed around hundreds of SSSIs, and several protected areas and beauty...
Aug 29, 2017 - This is a developing story and will be updated (December 17) Fracking permits offered in the second tranche of the 14th oil and gas licensing round include...
https://robinwestenra.blogspot.com/2012/01/opposing-fracking-in-south-africa.html
Seemorerocks: Opposing fracking in South Africa
seemorerocksopposingfrackingsouthafrica
https://www.greenpeace.org/usa/predatory-companies/
Fracking: Predatory Companies - Greenpeace - Greenpeace
frackingpredatorycompaniesgreenpeace
https://www.psu.edu/news/agricultural-sciences/story/webinar-explore-where-fracking-water-goes-shale-gas-production
Webinar to explore where fracking water goes in shale-gas production | Penn State University
When hydrofracturing of a shale-gas well occurs, millions of gallons of water is injected deep underground at high pressure. Normally, only a fourth to a fifth...
https://www.kqed.org/news/4656/new-state-plan-to-protect-underground-drinking-water-from-fracking-waste
New State Plan to Protect Underground Drinking Water from Fracking Waste | KQED
The state has drafted a plan to make sure oil companies don't contaminate underground drinking water. That's in response to a federal deadline and amid reports...
plan to protectnew state
https://www.umweltbundesamt.de/themen/wasser/gewaesser/grundwasser/nutzung-belastungen/fracking
Fracking | Umweltbundesamt
frackingumweltbundesamt
https://www.digitaljournal.com/world/trump-administration-moves-to-repeal-fracking-regulations/article/498498
Trump administration moves to repeal fracking regulations - Digital Journal
Jul 26, 2017 - President Barack Obama's administration formulated the rule in 2015 in an effort to update decades-old regulations because of the explosive growth of
trump administrationmovesrepealfrackingregulations
https://downwithtyranny.blogspot.com/2012/03/tim-holden-is-fracking-up-pennsylvania.html
DownWithTyranny!: Tim Holden Is Fracking Up Pennsylvania
downwithtyrannytimholdenfrackingpennsylvania
https://globalnews.ca/news/9234863/nb-first-nations-fracking/
First Nations in N.B. not consulted on proposal to revive hydraulic fracking - New Brunswick |...
Premier Blaine Higgs says hydraulic fracturing is on the table, despite First Nation leaders saying there were not consulted prior to it being mentioned in the...
https://wduqnews.blogspot.com/2011/04/chesapeake-stops-fracking-during.html
WDUQNews: Chesapeake Stops Fracking During Investigation
Crews are still trying to stop a major fracking fluid leak at a Bradford County natural gas well. Meantime, Chesapeake Energy is shutting do...
chesapeakestopsfrackinginvestigation
https://www.denverpost.com/business/energy/
Energy, mining, fracking, natural resources, oil and gas news | The Denver Post
Energy and commerce news about Colorado and national mining companies including profits, jobs, fracking, expansion, natural gas and oil by The Denver Post.
oil and gas newsnatural resources
https://www.usgs.gov/faqs/does-fracking-cause-earthquakes
Does fracking cause earthquakes? | U.S. Geological Survey
Most induced earthquakes are not directly caused by hydraulic fracturing (fracking). The recent increase in earthquakes in the central United States is...
u sfrackingcauseearthquakesgeological
https://uwaterloo.ca/water-institute/events/symposium-fracking-permafrost-environment-key-questions-0
Symposium: Fracking in a Permafrost Environment: Key Questions | Water Institute | University of...
The Program on Water Issues at the Munk School of Global Affairs at the Univesrity of Toronto is hosting a symposium titled: Fracking in a Permafrost...
in a
https://bfi.uchicago.edu/news/the-best-case-for-and-against-a-fracking-ban/
The Best Case For And Against A Fracking Ban | Becker Friedman Institute
for and againstthe best
https://www.nofrackingway.us/
No Fracking Way – Speaking out to protect our communities and environment
Speaking out to protect our communities and environment Fracker Sues DEC Over Non Existence Gas Reserves
speaking out
https://case.edu/news/civil-engineerings-david-zeng-helps-fact-check-fracking-claims
Civil engineering's David Zeng helps fact check fracking claims | CWRU Newsroom | Case Western...
May 22, 2025 - Fact checking fracking: Can fracking trigger earthquakes? ideastream: A series of earthquakes in the area last year made big news, especially after th...
https://traverselife.blogspot.com/2012/04/climate-matters-f-is-for-fracking-and.html?showComment=1333692684636
traverselife: Climate Matters. F is for Fracking and Fossil Fuels
This is the post for F in the A-Z Blogging Challenge 2012. Link in the sidebar. Fracking is when gas trapped deep underground is released...
f is forclimate mattersfrackingfossilfuels
https://www.latimes.com/opinion/story/2021-12-17/fracking-permits
Did California issue its last fracking permit? Let's hope so - Los Angeles Times
Dec 17, 2021 - California oil and gas regulators have begun denying permits for hydraulic fracturing citing the damage to the climate. Let's hope this is what the oil...
https://www.commondreams.org/newswire/2011/06/27/industry-insider-skepticism-over-shale-gas-fracking-reinforces-need-federal-ban
Experts Doubt Shale Gas Fracking, Urging Federal Ban | Common Dreams
shale gasexpertsdoubtfrackingurging
https://www.salon.com/2013/10/02/dangerous_levels_of_radiation_from_fracking_found_in_pa_water/?source=newsletter
Dangerous levels of radiation from fracking found in PA water - Salon.com
Oct 2, 2013 - Researchers found 200 times the normal amount of radium downstream of a treatment plant
https://stylingdutchman.blogspot.com/2011/03/fracking-floral.html
Fracking Floral - THE STYLING DUTCHMAN.
Paws up for those who get the Battlestar Galactica reference! This dress? This silk epitomy of spring? 1 euro. THAT'S RIGHT. I want to ma...
frackingfloralstylingdutchman
https://bsnorrell.blogspot.com/2015/11/video-native-kandi-mossett-in-paris-for.html?m=0
CENSORED NEWS: Video: Native Kandi Mossett in Paris for future generations: Stop fracking!
Censored News is a service to grassroots Indigenous Peoples engaged in resistance and upholding human rights.
https://www.commondreams.org/news/2015/02/12/reversing-course-uk-opens-national-parks-fracking
Reversing Course, UK Opens National Parks to Fracking | Common Dreams
Feb 27, 2025 - Environmental groups say lawmakers' backpedaling could pave way for fracking near drinking water sources
national parksreversingcourseukopens
https://focusonfracking.blogspot.com/2019/06/opec-report-shows-2nd-quarter-global.html
Focus on Fracking: OPEC report shows 2nd quarter global oil output running a million barrels per...
oil prices fell for the 3rd week in four this week, despite an attack on oil product tankers near the Strait of Hormuz that had all the ear...
https://mideastenvironment.apps01.yorku.ca/2016/06/fracking-is-bad-for-your-health-health-ministry-official-says-jerusalem-post/
Environment and Climate in the Middle East - Fracking is bad for your health, Health Ministry...
in the middle eastenvironment and climate
https://reflexionesfinales.blogspot.com/2015/08/the-christmas-ghost-of-fracking-past.html
reflexiones finales: The Christmas ghost of fracking past, present, and future
Peak Oil was generally supposed to mean ever escalating prices as the demand for oil pushed oil/gas/energy exploration further into the sph...
reflexiones finalesthe christmaspast presentghost
https://johnhanger.blogspot.com/2013/02/stunning-fact-air-emissions-from.html
John Hanger's Facts of The Day: Stunning Fact: Air Emissions From "Fracking" Can Be Cut By 90% & 4...
Now is the time to maximize the net air benefits of using more natural gas, and there are 4 key actions that must be taken to do so. No do...
https://frack.skytruth.org/
Skytruthing Fracking
SkyTruth Drilling Alerts is a repository of natural gas and oil drilling publications from SkyTruth. This includes maps, images, graphics and other information...
fracking
https://www.commondreams.org/views/2014/09/16/changes-everything-including-anti-fracking-movement
Opinion | 'This Changes Everything' Including the Anti-Fracking Movement | Common Dreams
Feb 26, 2025 - Among its many demonstrations, This Changes Everything, reveals how the grassroots anti-fracking movement is right where it should be--except for decades-old...
this changes everythingopinionincluding
https://geoarchitektur.blogspot.com/p/film-abschrift-atom-underground-nuclear.html
Geoarchitektur, Geoengineering: Film Abschrift: DER ATOMARE UNTERGRUND | NUKLEARES FRACKING VON...
geoengineering climate change chemtrails klimawandel water hydraulic fracturing fracking qatar arabia emirates jetstream atmosphere CO2
geoengineeringfilmderuntergrundfracking
https://traverselife.blogspot.com/2012/04/climate-matters-f-is-for-fracking-and.html?showComment=1333730267800
traverselife: Climate Matters. F is for Fracking and Fossil Fuels
This is the post for F in the A-Z Blogging Challenge 2012. Link in the sidebar. Fracking is when gas trapped deep underground is released...
f is forclimate mattersfrackingfossilfuels
https://collaborate.princeton.edu/en/publications/voters-and-donors-the-unequal-political-consequences-of-fracking/
Voters and Donors: The Unequal Political Consequences of Fracking - Princeton University
votersdonorsunequal
https://peterblack.blogspot.com/2026/02/reform-embracing-fracking.html?m=0
Peter Black: Reform embracing fracking
peter blackreformembracingfracking
https://caselaw.nationalarchives.gov.uk/ewhc/qb/2019/146
Barlow (On Behalf of Harthill Against Fracking) v Secretary of State for Housing, Communities And...
https://www.texassharon.com/
Texas Sharon's Bluedaze - Fracking News
texassharonfrackingnews
https://frac-source.com/
Frac Source - New and Refurbished Oil Field and Fracking Equipment
Need Oil Field or Fracking Equipment? Let us help you find the right equipment for your fracking / oilfield needs.
oil field frackingsource newrefurbishedequipment
https://www.commondreams.org/newswire/2016/08/29/momentum-continues-grow-opposition-fracking-more-70-brazilian-cities-approve
Momentum grows against fracking: 70+ Brazilian cities ban it. | Common Dreams
Aug 29, 2016 - Last week saw two more Brazilian cities prohibit fracking, reaching a total number of 72 since the launch of the No Fracking Brazil campaign in 2013.Fracking...
ban itmomentumgrowsfracking
https://aberavonneathlibdems.blogspot.com/2018/05/lib-dems-team-up-with-expert-to-call.html
Aberavon & Neath Liberal Democrats: Lib Dems team up with expert to call for urgent new fracking...
Today [May 22nd], Liberal Democrat Energy and Climate Change spokesperson Lynne Featherstone hosts a talk with former President of the Ge...
https://develop.bigthink.com/articles/the-way-were-fighting-over-fracking-is-all-fracked-up/
The Way We're Fighting Over Fracking is All Fracked Up - Big Think
Sep 30, 2021 - Fracking is yet another example of the subjective, instinctive, affective way human cognition deals with risks.
https://www.thenation.com/article/archive/fracking-about-arrive-your-doorstep/
Is Fracking About to Arrive on Your Doorstep? | The Nation
on your doorstepfrackingarrivenation
https://southof5and20.blogspot.com/2011/04/ny-times-columnist-supports-fracking.html
South of 5 and 20: NY Times columnist supports fracking
Instapundit directs our attention to New York Times columnist Robert Nocera . Nocera thinks natural gas from the Marcellus Shale is a ble...
ny timessouthcolumnistsupportsfracking
https://southof5and20.blogspot.com/2011/11/pennsylvania-fracking-impacts-new-york.html
South of 5 and 20: Pennsylvania fracking impacts New York
Colonial Manor under construction It seems there's something of an economic upturn happening in Upstate New York's Southern Tier. Dema...
southpennsylvaniafrackingimpactsnew
https://www.foxbusiness.com/video/2566303723001
Can Fracking Keep Up With Rising Consumption? | Fox Business Video
Boosting U.S. Energy Production
keep upfox businessfrackingrisingconsumption
https://irjci.blogspot.com/2013/12/colo-study-of-fracking-spill-sites.html
The Rural Blog: Colo. study of fracking spill sites finds chemicals linked to infertility, birth...
"Water samples collected at Colorado sites where hydraulic fracturing was used to extract natural gas show the presence of chemicals that ...
https://news.berkeley.edu/2017/01/11/noise-pollution-from-fracking-may-harm-human-health/
Noise pollution from fracking may harm human health - Berkeley News
noise pollutionhuman healthfrackingmayharm
https://www.salon.com/2015/07/01/fracking_is_using_up_an_increasingly_massive_amount_of_water_in_drought_prone_areas/
Fracking is using up an increasingly massive amount of water in drought-prone areas - Salon.com
Jul 1, 2015 - Fracked wells require more than 18 times the amount of water they used to, a new USGS study found
https://www.foxnews.com/video/6363596956112
American Petroleum Institute calls out Kamala Harris' continued fracking confusion: 'Very...
American Petroleum Institute President Mike Sommers joins 'America's Newsroom' to discuss Vice President Kamala Harris' repeated flip-flops on fracking.
american petroleum institutekamala harriscalls
https://www.commondreams.org/news/2014/08/06/boss-who-ordered-employees-dump-fracking-waste-river-hit-prison-sentence
Boss Who Ordered Employees to Dump Fracking Waste in River Hit With Prison Sentence | Common Dreams
Jul 18, 2024 - Contractor given 28-month prison sentence, $25,000 fine by U.S. district judge
https://www.commondreams.org/news/2014/04/15/study-fracking-emissions-1000x-higher-epa-estimates
Study: Fracking Emissions Up To 1000x Higher Than EPA Estimates | Common Dreams
Feb 27, 2025 - New report suggests highly potent greenhouse gas far more prevalent in gas production than previously thought
up to
https://magazine.wharton.upenn.edu/tag/pennsylvania-fracking/
Pennsylvania fracking Archives - Wharton Magazine
pennsylvaniafrackingarchiveswhartonmagazine
https://wduqnews.blogspot.com/2010/06/stricter-rules-on-fracing-water.html
WDUQNews: Stricter Rules on Fracking Water
A state regulatory commission has signed off on increased water quality standards that will limit what natural gas drillers can dump into Pe...
rulesfrackingwater
https://odysee.com/@IndLeftNews:3/how-did-we-miss-that-ep-48:d
Ukraine | AZ Sheriff Drags Feet | Fracking=Leukemia? | AMZN-OneMedical | How Did We Miss That #48
All links found at our Substack:
https://www.arabnews.com/smart-fracking-will-cut-costs-and-save-environment
Smart fracking will cut costs and save environment | Arab News
Jul 9, 2012 - LONDON: Pressure to respond to falling oil and gas prices by cutting operating costs, coupled with the need to reduce the social and environmental footprint on...
cut costssave environmentsmartfrackingarab
https://dialog-erdgasundfrac.de/
Fracking, Erdgassuche in Deutschland | Dialog Plattform
Informations und Dialogprozess über die Sicherheit und Umweltverträglichkeit der Fracking Technologie zur Erdgasgewinnung bzw. Gewinnung von Schiefergas.
in deutschlandfrackingdialogplattform
https://wtfrackorg.blogspot.com/p/fracking-videos.html
WTFrack.org: Fracking Videos
Please voice your thoughts on these videos. Many were made by the drilling companies to assert 'fracking' safety. Your voice counts, so le...
frackingvideos
https://yborcitystogie.blogspot.com/2015/04/gop-florida-frackers-pass-fracking-bill.html
The Ybor City Stogie: GOP Florida Frackers Pass Fracking Bill
ybor citygopfloridapassfracking
https://pure.psu.edu/en/publications/project-asks-whats-in-the-water-after-fracking-at-depth/
Project asks what's in the water after fracking at depth - Penn State
in the water
https://irjci.blogspot.com/2016/08/trump-causing-concern-among-oil-and-gas.html
The Rural Blog: Trump causes concern among oil and gas industry with comments on local fracking bans
Republican presidential nominee Donald Trump has raised some eyebrows with his recent remarks about hydraulic fracturing, Timothy Cama repor...
https://www.latimes.com/politics/liveblog/2024-election-harris-walz-interview-cnn
Live updates: No fracking ban, Harris says in first interview with CNN - Los Angeles Times
Vice President Kamala Harris and Minnesota Gov. Tim Walz gave their first interview since becoming the Democratic nominees.
https://petition.parliament.uk/petitions/728912?link_id=7&can_id=35319b04d7c7428991bc9a5feaeed70b&source=email-newsletter-35-from-frack-free-coastal-communities&email_referrer=email_3176098&email_subject=newsletter-36-from-frack-free-coastal-communities&&
Ban "small-scale fracking" for onshore oil and gas - Petitions
Fracking forces fluid into rocks to open cracks so oil or gas can flow out. It was banned in 2019 after being blamed for causing earthquakes in shale gas...
oil and gassmall scalebanfrackingonshore
https://usa.chinadaily.com.cn/epaper/2014-06/13/content_17585548.htm
Panel debates use of fracking for gas in China|Across America|chinadaily.com.cn
To get away from its dependency on air-polluting coal and to keep its economy expanding, China has turned to fracking, the blasting of sand, water and...
https://www.atlanticcouncil.org/unused/webcasts/can-fracking-survive-the-impact-of-low-oil-prices-and-prospects-for-international-expansion/
Can Fracking Survive? The Impact of Low Oil Prices and Prospects for International Expansion -...
May 11, 2015 - Please join the Atlantic Council on Monday, May 11, 2015 from 3:00 p.m.to 4:30 p.m. for a discussion on how low oil prices have im
https://www.salon.com/2014/04/04/pennsylvania_fails_to_report_water_contamination_from_fracking/
Pennsylvania fails to report water contamination from fracking - Salon.com
Apr 5, 2014 - It's the "practice" of the state DEP not to say anything when private wells are polluted
to reportwater contaminationpennsylvaniafailsfracking