https://liveforever.club/resources/rare-genetic-variants-support-human-superlongevity-joris-deelen-at-longevity-summit-dublin-2024
Rare Genetic Variants Support Human Superlongevity - Joris Deelen at Longevity Summit Dublin 2024
Joris Deelen delivered a keynote on how rare genetic variants support human superlongevity
genetic variantsraresupporthumansuperlongevity
https://nanoporetech.com/ja/resource-centre/simultaneous-de-novo-calling-and-phasing-of-genetic-variants-at-chromosome-scale-using-nanostrand-seq
Simultaneous de novo calling and phasing of genetic variants at chromosome-scale using...
May 7, 2026 - Publication: Simultaneous de novo calling and phasing of genetic variants at chromosome-scale using NanoStrand-seq
de novogenetic variantssimultaneouscallingphasing
https://arts.units.it/handle/11368/2713090
NALP1/NLRP1 genetic variants are associated with Alzheimer disease.
genetic variantsassociated withalzheimer disease
https://einstein.elsevierpure.com/en/publications/two-novel-genetic-variants-in-the-stk38l-and-rab27a-genes-are-ass/
Two novel genetic variants in the STK38L and RAB27A genes are associated with glioma susceptibility...
genetic variantsassociated withtwonovelgenes
https://pure.urosario.edu.co/en/publications/semiconductor-whole-exome-sequencing-for-the-identification-of-ge/
Semiconductor Whole Exome Sequencing for the Identification of Genetic Variants in Colombian...
whole exome sequencingfor thegenetic variantssemiconductoridentification
https://pubmed.ncbi.nlm.nih.gov/22848671/
Association of eleven common, low-penetrance colorectal cancer susceptibility genetic variants at...
We did not find evidence of association of CRC risk variants with patient survival.
colorectal cancergenetic variantsassociationelevencommon
https://health.uct.ac.za/hpals/events/polygenic-influence-genetic-variants-acl-rupture-risk-across-multiple-international-cohorts
The polygenic influence of genetic variants on ACL rupture risk across multiple international...
Professor Alison V. September
genetic variantsinfluenceaclrupturerisk
https://bonndoc.ulb.uni-bonn.de/xmlui/handle/20.500.11811/13339
Across Diagnostic Boundaries: Genetic Variants for Neuropsychiatric Disorders and their Association...
genetic variantsacrossdiagnosticboundariesdisorders
https://repository.icr.ac.uk/items/fcc841c9-7af7-4a1c-b457-eadcba3afa2e
Characterizing genetic variants for clinical action.
Genome-wide association studies, DNA sequencing studies, and other genomic studies are finding an increasing number of genetic variants associated with...
genetic variantsclinicalaction
https://www.mskcc.org/news-releases/genetic-variants-may-affect-risk-breast-women-brca2-mutations
Genetic Variants May Affect the Risk of Breast Cancer in Women with BRCA2 Mutations | Memorial...
An international study led by researchers at Memorial Sloan Kettering Cancer Center has identified genetic variants in women with BRCA2 mutations that may...
genetic variantsbreast cancermayaffectrisk
https://collaborate.princeton.edu/en/publications/genetic-variants-linked-to-education-predict-longevity/
Genetic variants linked to education predict longevity - Princeton University
genetic variantsprinceton universitylinkededucationpredict
https://pure.eur.nl/en/publications/influence-of-genetic-variants-on-childhood-lung-function-the-gene/
Influence of genetic variants on childhood lung function - The Generation R Study - Erasmus...
genetic variantslung functionthe generationinfluencechildhood
https://www.medsci.org/v23p1782.htm
Unraveling Research Trends and Hotspots of Genetic Variants in Acute Leukemias: A Web of Science...
Unraveling Research Trends and Hotspots of Genetic Variants in Acute Leukemias: A Web of Science and Scopus-Based Bibliometric Study
research trendsgenetic variantsacute leukemiasweb scienceunraveling
https://research.vu.nl/en/publications/association-of-adiposity-genetic-variants-with-menarche-timing-in/
Association of Adiposity Genetic Variants With Menarche Timing in 92,105 Women of European Descent...
genetic variantsassociationmenarchetimingwomen
https://www.mpi.nl/publications/item3587881/genetic-variants-head-size-share-genes-and-pathways-cancer
Genetic variants for head size share genes and pathways with cancer | Max Planck Institute
max planck institutegenetic variantshead sizewith cancershare
https://www.sciencedaily.com/releases/2015/11/151130125248.htm
Schizophrenia-associated genetic variants affect gene regulation in the developing brain |...
An international research collaboration has shed new light on how DNA sequence variation can influence gene activity in the developing human brain. The team...
genetic variantsschizophreniaassociatedaffectregulation
https://asoi.info/publication/implication-of-genetic-variants-in-overweight-and-obesity-susceptibility-among-the-young-arab-population-of-the-united-arab-emirates/
Implication of genetic variants in overweight and obesity susceptibility among the young Arab...
overweight and obesitygenetic variantsthe youngimplicationsusceptibility
https://www.mlo-online.com/molecular/genomics/article/21085808/study-of-multiethnic-genomes-identifies-27-genetic-variants-associated-with-disease
Study of multiethnic genomes identifies 27 genetic variants associated with disease | MLO Online
According to a news release, in a study published in the journal Nature, researchers identified 27 new genomic variants associated with conditions such as...
genetic variantsassociated withstudygenomesdisease
https://fulir.irb.hr/4400/
Genetic Variants of theBrain-Derived Neurotrophic Factorand Metabolic Indices in Veterans With...
genetic variantsthebrainderivedmetabolicindices
https://ricerca.unich.it/handle/11564/676494
Prognostic significance of genetic variants in the IL-23/Th17 pathway for the outcome of T...
genetic variantssignificanceilpathwayoutcome
https://scholars.duke.edu/publication/1230342
Scholars@Duke publication: No evidence for the presence of genetic variants predisposing to...
for thegenetic variantsscholarsdukepublication
https://i-rep.emu.edu.tr/items/e6279656-0a06-4356-82ba-1ee42143c577
Genetic variants of folate metabolism and the risk of multiple sclerosis
Background and aimsMultiple sclerosis (MS) is a chronic inflammatory disease of the central nervous system (CNS) of unknown cause. Alterations in one-carbon...
genetic variantsmultiple sclerosisfolatemetabolismrisk
https://oulurepo.oulu.fi/handle/10024/46601
Characterization of genetic variants in the EGLN1/PHD2 gene identified in a European collection of...
genetic variantscharacterizationidentifiedeuropeancollection
https://bioengineer.org/genetic-variants-linked-to-single-parity-loss-in-pigs-2/
Genetic Variants Linked to Single-Parity Loss in Pigs - BIOENGINEER.ORG
genetic variantslinkedsingleparityloss
https://edoc.mdc-berlin.de/id/eprint/6417/
Systematic analysis of the regulatory and essential myosin light chain genes: genetic variants and...
genetic variantssystematicanalysisregulatoryessential
https://www.xcode.life/23andme-raw-data/analyze-dna-raw-data-photic-sneeze/
Have Your DNA Raw Data? Check Your Genetic Variants For Depression
Sep 30, 2020 - Upload your DNA raw data from 23andMe, AncestryDNA, or FTDNA to Xcode Life to know about the genetic variants for photic sneeze.
raw datagenetic variantsfor depressiondnacheck
https://elmi.hbku.edu.qa/en/publications/identification-of-371-genetic-variants-for-age-at-first-sex-and-b/
Identification of 371 genetic variants for age at first sex and birth linked to externalising...
genetic variantsfirst sexidentificationagebirth
https://www.progress.org.uk/genetic-variants-linked-to-fertility-identified/
Genetic variants linked to fertility identified | PET
Oct 23, 2025 - The number of children a person has may be influenced by their genome, according to an international study...
genetic variantslinkedfertilityidentifiedpet
https://www.alliedacademies.org/articles/genetic-variants-affecting-insulin-signaling-pathways-and-risk-of-diabetes-a-comprehensive-systematic-review-28063.html
Genetic Variants Affecting Insulin Signaling Pathways and Risk of Diabetes: A Comprehensive...
Purpose: The complicated condition known as type 2 diabetes mellitus (T2DM) has a diverse genetic and environment-related cause. MIM125853 is among the...
genetic variantssignaling pathwaysinsulinriskdiabetes
https://pure.ug.edu.gh/en/publications/key-genetic-variants-associated-with-variation-of-milk-oligosacch/
Key genetic variants associated with variation of milk oligosaccharides from diverse human...
genetic variantsassociated withkeyvariationmilk
https://www.frontiersin.org/journals/cardiovascular-medicine/articles/10.3389/fcvm.2021.704501/full
Frontiers | Effect of NPC1L1 and HMGCR Genetic Variants With Premature Triple-Vessel Coronary...
Background: Both Niemann-Pick C1-like 1 (NPC1L1) and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR) play a key role on dyslipidaemia. We aim to eval...
genetic variantsfrontierseffectprematuretriple
https://abstracts.eurospe.org/hrp/0097/hrp0097fc7.4
The effect of common genetic variants in CYP19A1 on serum Estradiol to Testosterone Ratio in...
the effectgenetic variantscommonserumestradiol
https://clpmag.com/diagnostic-technologies/molecular-diagnostics/optical-genome-mapping-detects-additional-genetic-variants-acute-leukemia/
Optical Genome Mapping Catches Missed Genetic Variants in Nearly 20% of Acute Leukemia Cases |...
Apr 21, 2026 - Optical genome mapping (OGM) detected additional, clinically significant genetic variants in nearly 20% of acute leukemia patients.
optical genome mappinggenetic variantsacute leukemiacatchesmissed
https://eprints.lib.hokudai.ac.jp/repo/huscap/all/44388/
Genetic variants in mannose receptor gene (MRC1) confer susceptibility to increased risk of...
genetic variantsincreased riskmannosereceptorconfer
https://researchcollaborations.elsevier.com/en/publications/a-large-scale-analysis-of-genetic-variants-within-putative-mirna-/
A large-scale analysis of genetic variants within putative miRNA binding sites in prostate cancer -...
large scalegenetic variantsprostate canceranalysiswithin
https://www.drsharma.ca/hindsight-g-protein-genetic-variants-and-obesity
Hindsight: G-Protein Genetic Variants and Obesity | Dr. Sharma's Obesity Notes
g proteingenetic variantshindsightobesitydr
https://septentrio.uit.no/index.php/rangifer/article/view/275
Finnish and Norwegian reindeer milk betalactoglobulin; characterization of genetic variants |...
genetic variantsfinnishnorwegianreindeermilk
https://publires.unicatt.it/en/publications/association-of-genetic-variants-in-cdk6-and-xrcc1-with-the-risk-o-8/
Association of genetic variants in CDK6 and XRCC1 with the risk of dysplastic nevi in...
genetic variantsassociationrisknevi
https://www.microbiosci.com/posts/the-hidden-world-of-borrelia-afzelii-how-genetic-variants-shape-a-tickborne-disease
The Hidden World of Borrelia Afzelii: How Genetic Variants Shape a Tick-Borne Disease
Explore the genetic diversity of Borrelia afzelii and how different variants influence Lyme disease transmission, symptoms, and treatment outcomes.
the hiddenworld ofgenetic variantstick borneborrelia
https://www.mitacs.ca/our-projects/developing-statistical-methods-to-discover-genetic-variants-underlying-longitudinal-decline-in-lung-function/
Developing statistical methods to discover genetic variants underlying longitudinal decline in lung...
COPD is a common inflammatory lung condition that is characterized by airflow limitation and symptoms of cough and shortness of breath. Globally, it affects...
statistical methodsgenetic variantsdevelopingdiscoverunderlying
https://deep.ai/publication/brca-gene-mutations-in-dbsnp-a-visual-exploration-of-genetic-variants
BRCA Gene Mutations in dbSNP: A Visual Exploration of Genetic Variants | DeepAI
Sep 1, 2023 - 09/01/23 - BRCA genes, comprising BRCA1 and BRCA2 play indispensable roles in preserving genomic stability and facilitating DNA repair mechan...
brca genegenetic variantsmutationsvisualexploration
https://urgi.versailles.inrae.fr/faidare/studies/dXJuOkVWQS9zdHVkeS9QUkpFQjQ1MDc1
Study : Investigation of millet genetic variants
genetic variantsstudyinvestigationmillet
https://cris.maastrichtuniversity.nl/en/activities/modeling-of-mechanical-loading-and-genetic-variants-in-osteoarthr/
Modeling Of Mechanical Loading and Genetic Variants in Osteoarthritis - From in vitro models to...
genetic variantsmodelingmechanicalloadingosteoarthritis
https://researchportal.scu.edu.au/esploro/outputs/journalArticle/Genetic-Variants-within-NOGGIN-COL1A1-COL5A1/991013087510602368
Genetic Variants within NOGGIN, COL1A1, COL5A1, and IGF2 are Associated with Musculoskeletal...
genetic variantsassociated withwithinnogginmusculoskeletal
https://research.uni-luebeck.de/de/publications/pcsk9-genetic-variants-and-risk-of-type-2-diabetes-a-mendelian-ra/fingerprints/
PCSK9 genetic variants and risk of type 2 diabetes: A mendelian randomisation study - Fingerprint -...
genetic variantsmendelian randomisationrisktypediabetes
https://www.broadinstitute.org/publications/broad1375956
ClinGen API platform for classification of human genetic variants. | Broad Institute
api platformgenetic variantsclassificationhumanbroad
https://www.elrha.org/resource/association-of-maoa-genetic-variants-and-resilience-with-psychosocial-stress-a-longitudinal-study-of-syrian-refugees----copy
Association of MAOA genetic variants and resilience with psychosocial stress: A longitudinal study...
Association of MAOA genetic variants and resilience with psychosocial stress: A longitudinal study of Syrian refugees -- Copy
genetic variantslongitudinal studyassociationresiliencepsychosocial
https://aesnet.org/abstractslisting/cardiac-arrhythmia--and-epilepsy-related-genetic-variants-in-sudden-unexpected-death-in-epilepsy
Cardiac-Arrhythmia--and-Epilepsy-Related-Genetic-Variants-in-Sudden-Unexpected-Death-in-Epilepsy
cardiac arrhythmiagenetic variantsepilepsyrelatedsudden
https://www.nsf.gov/news/crispr-single-cell-sequencing-pinpoint-causal-genetic
CRISPR and single-cell sequencing pinpoint causal genetic variants for traits and diseases | NSF -...
A major challenge in human genetics is understanding which parts of the genome drive specific traits or contribute to disease risk. This challenge is even...
single cell sequencinggenetic variantscrisprpinpointcausal
https://connect.uclahealth.org/dom/2025/01/16/genetic-variants-associated-with-the-biochemical-response-to-vitamin-d3-in-the-multi-ethnic-study-of-atherosclerosis/
Genetic Variants Associated with the Biochemical Response to Vitamin D3 in the Multi-Ethnic Study...
Best CM, Li X, Rotter JI, Prince DK, Hsu S, Hoofnagle AN, Siscovick D, Taylor KD, Williams K, Michos ED, [...]
genetic variantsassociated withbiochemicalresponsevitamin
https://www.uab.edu/news/research-innovation/study-links-genetic-variants-to-increased-risk-of-heart-failure
Study links genetic variants to increased risk of heart failure | UAB News
Study links genetic variants to increased risk of heart failure
study linksgenetic variantsincreased riskheart failureuab news
https://open.clemson.edu/all_dissertations/2007/
"Identification of Genetic Variants Underlying Simple and Complex Canin" by Jacquelyn Marie Evans
The unique population structure of dog breeds, arising from their domestication from gray wolves and subsequent breed formation, and the similarity of their...
genetic variantsidentificationunderlyingsimplecomplex
https://iris.unisr.it/handle/20.500.11768/133059
Identification of genetic variants contributing to pain-related symptoms in familial and sporadic...
genetic variantsidentificationcontributingpainrelated
https://www.scoop.it/topic/genetics-by-geg-tech/p/4037844752/2015/02/24/identification-of-common-genetic-variants-controlling-transcript-isoform-variation-in-human-whole-blood-nature-genetics-nature-publishing-group
Identification of common genetic variants contr...
Christopher O'Donnell and colleagues report a genome-wide screen for splicing quantitative trait loci (sQTLs) in 5,257 human blood samples. They identify cis...
genetic variantsidentificationcommon
https://iris.uniupo.it/handle/11579/118648
Periostin Circulating Levels and Genetic Variants in Patients with Non-Alcoholic Fatty Liver Disease
fatty liver diseasegenetic variantsin patientsnon alcoholiclevels
https://faculty.ksu.edu.sa/en/aalenad/publication/412191
Genetic Variants of HNF4A, WFS1, DUSP9, FTO, and ZFAND6 Genes Are Associated with Prediabetes...
genetic variantsassociated withftogenesprediabetes
https://www.thenational.academy/teachers/programmes/biology-secondary-ks4-higher-aqa/units/dna-and-the-genome/lessons/genetic-variants-in-genes-can-influence-phenotype
Genetic variants in genes can influence phenotype Higher AQA KS4 | Y10 Biology Lesson Resources |...
View lesson content and choose resources to download or share
genetic variantslesson resourcesgenesinfluencephenotype
https://cris.fau.de/publications/306957536/
Spectrum and frequency of genetic variants in sporadic amyotrophic lateral sclerosis - FAU CRIS
amyotrophic lateral sclerosisgenetic variantsspectrumfrequencysporadic
https://research.wur.nl/en/datasets/supporting-data-for-identifying-candidate-genetic-variants-for-eg/
Supporting data for "Identifying candidate genetic variants for egg number by analyzing over 1000...
supporting datagenetic variantsidentifyingcandidateegg
https://www.epistemonikos.org/en/documents/b929baedc42b9bbd2bed4fd468a735779103ccf7
Machine learning identifies six genetic variants and alterations in the Heart Atrial Appendage as...
Parkinsons disease (PD) is a complex neurodegenerative disease with a range of causes and clinical presentations. Over 76 genetic loci (comprising 90 SNPs) h...
machine learninggenetic variantsthe heartsixalterations
https://scholar.xjtu.edu.cn/en/publications/%E8%82%BE%E8%83%BA%E9%85%B6%E5%9F%BA%E5%9B%A0%E5%A4%9A%E6%80%81%E6%80%A7%E4%B8%8E%E8%A1%80%E5%8E%8B%E9%92%A0%E9%92%BE%E5%8F%8D%E5%BA%94%E6%80%A7%E7%9A%84%E7%9B%B8%E5%85%B3%E6%80%A7%E5%88%86%E6%9E%90/
Association of genetic variants in renalase with blood pressure responses to salt and potassium...
genetic variantsblood pressureassociationresponsessalt
https://biovoicenews.com/medgenomes-novel-software-to-detect-genetic-variants-for-rare-diseases-inherited-cancers/
MedGenome's novel software to detect genetic variants for rare diseases & inherited cancers -...
Apr 21, 2022 - The software claims to accurately predict and rank a pathogenic variant in 90% of rare diseases cases with no or minimum manual intervention
genetic variantsrare diseasesinherited cancersnovelsoftware
https://hsrc.himmelfarb.gwu.edu/gwhpubs/6439/
"Genetic variants of accessory proteins and G proteins in human genetic" by Miles D. Thompson,...
We present a series of three articles on the genetics and pharmacogenetics of G protein- coupled receptors (GPCR). In the first article, we discuss genetic...
genetic variantsby milesaccessoryproteinshuman
https://pure.lib.cgu.edu.tw/en/publications/review-of-pharmacogenetics-of-antiseizure-medications-focusing-on/
Review of pharmacogenetics of antiseizure medications: focusing on genetic variants of mechanistic...
review ofgenetic variantspharmacogeneticsmedicationsfocusing
https://www.mjhid.org/index.php/mjhid/article/view/2019.013/3577
View of BONE MINERAL DENSITY AND VITAMIN D RECEPTOR GENETIC VARIANTS IN EGYPTIAN CHILDREN WITH BETA...
bone mineral densitygenetic variantsviewvitaminreceptor
https://oxfordnanoporedx.com/ja/resource-centre/the-platinum-pedigree-a-long-read-benchmark-for-genetic-variants
The Platinum Pedigree: a long-read benchmark for genetic variants
May 7, 2026 - Publication: The Platinum Pedigree: a long-read benchmark for genetic variants
platinum pedigreelong readgenetic variantsbenchmark
https://researchconnect.stonybrook.edu/en/publications/cyp2c19-genetic-variants-affect-nelfinavir-pharmacokinetics-and-v/
CYP2C19 genetic variants affect nelfinavir pharmacokinetics and virologic response in...
genetic variantsaffectpharmacokineticsresponse
https://scholarworks.utrgv.edu/som_pub/614/
"Rare genetic variants explain missing heritability in smoking" by Seon-Kyeong Jang, Luke Evans et...
Common genetic variants explain less variation in complex phenotypes than inferred from family-based studies, and there is a debate on the source of this...
genetic variantsluke evansrareexplainmissing
https://research.regionh.dk/da/publications/genetic-variants-and-multiple-myeloma-risk-immense-validation-of-/
Genetic variants and multiple myeloma risk: IMMEnSE validation of the best reported...
genetic variantsmultiple myelomathe bestriskimmense
https://unipv.unifind.cineca.it/resource/item/17037?language=en-US
UNIFIND - UNIPV -Genetic variants showing apparent hot-spots in the human serum albumin gene.
Unifind is a portal where you can discover the expertise within a university by searching among experts, courses, professions, people, publications, and...
human serum albumingenetic variantshot spotsshowingapparent
https://virtual.keystonesymposia.org/p/s/disease-and-phenotype-relevant-genetic-variants-identified-from-histone-acetylomes-in-human-hearts-14344
Disease and Phenotype Relevant Genetic Variants Identified from Histone Acetylomes in Human Hearts...
genetic variantshuman heartsdiseasephenotyperelevant
https://egyptianstreets.com/2026/04/14/egypt-study-identifies-over-17-million-previously-undocumented-genetic-variants/
Egypt Study Identifies Over 17 Million Previously Undocumented Genetic Variants | Egyptian Streets
Apr 14, 2026 - Egypt has identified more than 17 million previously undocumented genetic variants in its first large-scale genome study, according to findings from the Egypt...
genetic variantsegyptian streetsstudymillionpreviously