Sponsored by eBay
personalized | Shop on eBay
Buy and sell on the world's online marketplace. Top brands, low prices, and free shipping on many items.
https://geneticshospital.com/
Genetics Hospital | Pioneering Genomic Medicine & Personalized Care
Welcome to Genetics Hospital. The world's leading facility for medical genetics, DNA sequencing, and personalized treatment. We decode the blueprint of life to...
genomic medicinegeneticshospitalpioneeringpersonalized
https://sheltonacademyschools.com/
Shelton Academy | Personalized Education, Rooted in Virtue
Where faith, family, and excellence shape tomorrow’s leaders. Discover a personalized Catholic education at Shelton Academy. Apply or schedule a tour today.
personalized educationsheltonacademyrootedvirtue
https://legacytouch.com/
Legacy Touch Personalized Fingerprint Jewelry and Keepsakes – LegacyTouch
Hold the people you love close with personalized Fingerprint Jewelry and Keepsakes. Create your own Pendants, Dog Tags, Rings, and more. Beautiful memorials...
jewelry and keepsakeslegacy touchpersonalizedfingerprintlegacytouch
https://egyptfuntours.com/
Egypt Fun Tours: Personalized, Unforgettable Egypt Tours
Jul 10, 2026 - Explore Cairo and beyond with Egypt Fun Tours—tailored adventures, expert guides, and authentic experiences for solo travelers. BOOK NOW!
fun toursegyptpersonalizedunforgettable
https://valice.com/
Valice – Personalized Hosting & Support Services
hosting supportvalicepersonalizedservices
https://eva-bloom.co/
Eva Bloom™ | Personalized Soulmate Sketch & Psychic Love Reading
Eva Bloom™ is a personalized psychic soulmate sketch service get 80% Off Today
soulmate sketchevapersonalizedpsychiclove
https://cozynames.com/
Personalized Blankets for Kids - Custom Cozy Gifts They'll Love
Jan 17, 2025 - Shop our adorable collection of personalized blankets for kids. Soft, cozy blankets make perfect gifts for babies, toddlers, and children.
personalized blanketsfor kidscozy giftscustomlove
https://freshmagnets.com/
Fresh Magnets - Custom Photo Magnets Coming Soon | Personalized Fridge Magnets
Fresh Magnets is launching soon. Custom photo magnets perfect for wedding save-the-dates, gifts, and events. Sign up for early access and design your own.
photo coming soonfreshmagnetscustompersonalized
https://customwrappingpapers.com/
Personalized Wrapping Paper: Custom Wrapping Paper with Your Photos
Oct 13, 2025 - Personalized wrapping paper to take your gift giving to the next level. We make custom wrapping paper with your face on it. Free shipping.
personalized wrapping papercustomphotos
https://craig-adam.com/
craig-adam.com: A Personalized Web Presence
craig-adam.com is a unique domain name, perfect for individuals or businesses seeking a personalized online presence.
craigadampersonalizedwebpresence
https://www.hallmarkcardssupply.com/
Hallmark - Premium Greeting Cards & Personalized Gifts
Hallmark offers premium greeting cards, boxed christmas cards, printable cards and custom designs. FSC certified, eco-friendly materials. Shop online or...
greeting cardshallmarkpremiumpersonalizedgifts
https://olson1to1.com/
olson1to1.com - Personalized Domain
olson1to1.com is a unique domain name, perfect for personalized services. Inquire about this domain today.
personalizeddomain
https://facepjs.com/
Face Pajamas - Personalized Photo Sleepwear | FacePJs
facepajamaspersonalizedphotosleepwear
https://kristijane.com/
Digital Marketing Personalized to Deliver Results - KristiJane.com
Sep 18, 2025 - More than digital marketing, we deep dive into our clients businesses - discover opportunities, fix problems, drive results - You ready?!
digital marketingdeliver resultspersonalized
https://en.personnalisemoi.com/
Leather bracelets with engraved messages and personalized watches
Leather bracelets and watches personalized by engraving, French handcrafted creations for personalized and unique gifts in leather, cork and wood
leather braceletsengravedmessagespersonalizedwatches
https://en.motsdebois.com/
Engraved wooden bow ties for personalized wedding gifts
Unique wooden items, personalized engraved, bow ties, jewelry, USB boxes, gifts to personalize by laser engraving
wooden bow tiespersonalized weddingengravedgifts
https://en.cuiretcarnets.fr/
Leather creations and personalized notebooks
Designer of leather goods for leather bags, clutches, purses, belts, unique handcrafted pieces made in France.
leathercreationspersonalizednotebooks
https://printpaws.com/product/custom-dog-blanket/
Personalized Dog Blankets | Custom Dog Blanket with Photo
Jun 20, 2025 - Create personalized dog blankets with your pet's photo and name. Premium soft blankets with vibrant printing, same-day proofing, and free shipping.
dog blanketspersonalizedcustomphoto
https://workbookpdf.com/
WorkbookPDF: Personalized Language Workbooks with AI
Unlock language learning with WorkbookPDF! Enjoy personalized, AI-powered workbooks tailored to your interests. Start your journey to fluency today!
workbookpdfpersonalizedlanguageworkbooksai
https://www.crowdsouth.com/
Bowling Green Marketing Agency, Consultants & Personalized Online Marketing Services
Mar 5, 2026 - Bowling Green marketing agency offering personalized online marketing, social media marketing consulting, and expert marketing consultants to grow your...
bowling greenmarketing agencyconsultantspersonalizedonline
https://www.sylvanlearning.com/
Sylvan Learning | Personalized Tutoring & Test Prep for K-12
Jan 7, 2025 - Get personalized tutoring, test prep and homework help from local tutors. Sylvan students see results—guaranteed! Learn about our proven, affordable tutoring.
prep for ksylvan learningpersonalized tutoringtest
https://www.onepeloton.com/
Peloton: Innovative exercise equipment and personalized workout plans
Discover Peloton’s fitness equipment and personalized workout plans. From cardio to strength, find an exercise program that keeps you motivated and on track.
exercise equipmentpelotoninnovativepersonalizedworkout
https://premierpersonalizedgifts.com/index.php?prices=YES
Premier Personalized Gifts
Make your gifts special with personalization. We offer a wide range of Customizable Gift Items.
premierpersonalizedgifts
https://storiko.com/en/
Bedtime Stories for Kids | Personalized Stories with Favorite Characters
Discover magical bedtime stories featuring your child's favorite characters from movies and games. Each story includes personalized adventures, beautiful...
bedtime stories for kidspersonalizedfavoritecharacters
https://songly.gift/en/
Create Personalized AI-Generated Song Gifts for Free | Custom Songs for Celebrations
Discover the magic of personalized song gifts with our AI-powered service. Create unique, custom songs for any celebration or special occasion for free. Enter...
personalized aisong giftsfor freecustom songscreate
https://www.d59contisuits.co.za/
D59 CONTISUITS – Custom Sublimated Shirts – Personalized Apparel for Unique Branding
sublimated shirtspersonalized apparelcontisuitscustom
https://www.oxvavapeworld.co.uk/
OXVA Vape: Innovative Technology, Personalized Experience
Jan 24, 2025 - The high performance of our OXVA vape makes it the best choice. Personalize your vaping experience with OXVA Vape.
oxva vapeinnovative technologypersonalizedexperience
https://www.renaissance.com/
Renaissance | Personalized teaching to help you See Every Student
Jun 24, 2026 - Educators trust Renaissance software solutions for K‒12 assessment and reading and math practice to increase student growth and mastery.
to helprenaissancepersonalizedteachingsee
https://www.nutrisense.io/
Nutrisense — Personalized Health Insights with 1:1 Coaching
Take control of your metabolism with glucose data and an action plan tailored to your body and life. Nutrisense pairs expert dietitian video calls with CGM...
personalized health insightsnutrisensecoaching
https://alphasignsanddesigns.ca/
Metal Signs Made in Canada|Business Sign Outdoor| Personalized Metal Art, Home Decor & More
made in canada
https://www.columbiabankonline.com/
Personalized Financial Solutions in NJ | Columbia Bank
Serving New Jersey since 1927, Columbia Bank offers tailored financial solutions to meet your needs. Discover our personal and business banking services to...
financial solutionspersonalizednjcolumbiabank
https://auburncrest.com/
Auburn Crest Hospice | Our private and personalized care provides comfort and support for those in...
https://www.wincustoms.com/
wincustoms Team Jerseys, Personalized Football, Baseball Basketball Hockey Jersey, Custom Jerseys
wincustoms all kinds of jerseys,custom,T-shirt jerseys,custom Hockeyjerseys,cheap nfl jerseys,can Save up to 70%!welcome to buy jerseys,nfl jerseys,cheap...
team jerseyspersonalizedfootballbaseballbasketball
https://premierpersonalizedgifts.com/
Premier Personalized Gifts
Make your gifts special with personalization. We offer a wide range of Customizable Gift Items.
premierpersonalizedgifts
https://www.custommonopoly.com/
Custom Monopoly Personalized Monopoly Games Printing Services
Apr 14, 2026 - Custom Monopoly Personalized Monopoly Games Printing Services, Custom opoly Game Producer USA Manufacturer custom monopoly board
custom monopolypersonalized gamesprintingservices
https://mcgiftcardmall.com/blog/holiday-gift-cards.html
50+ Best Holiday Gift Cards Ideas for Smart and Personalized Seasonal Gifting
Explore the best holiday gift cards, top brands, seasonal deals, and gifting ideas. Learn where and how to buy Happy Holidays cards for a stress free holiday...
holiday gift cardsideas for
https://www.strivepharmacy.com/
Tailored Compounding Pharmacy for Personalized Care | Strive Pharmacy
Strive Pharmacy delivers personalized medications for mental health, hormone therapy, weight loss, and more. Discover the power of tailored care today.
compounding pharmacypersonalized caretailoredstrive
https://www.cameo.com/
Cameo - Personalized videos feat. your favorite stars
Browse thousands of celebrities and request a personalized video message for any occasion. Get creative with your request, especially for celebrations like...
personalized videosyour favoritecameofeatstars
https://giftwrapmyface.com/
Custom Wrapping Paper Personalized for All Your Gifting Needs
Create personalized gift wrapping paper and custom items with your face, your pet's or the people you love. Proudly Made in the USA.
custom wrapping paperfor allpersonalizedgiftingneeds
https://www.diagnostics.abbott/us/en/home.html
Diagnostics at Abbott | Personalized Solutions for Better Healthcare Performance
Delivering personalized solutions across core lab, molecular, point of care, and transfusion medicine to help redefine performance in healthcare institutions.
personalized solutionsfor betterdiagnosticsabbotthealthcare
https://www.beautytestai.com/
Beauty Test AI | Personalized Beauty Score Cards | First Test Free
Transform your photos into detailed beauty score cards with our AI Beauty Test. Receive personalized ratings across five beauty dimensions, along with...
beauty testscore cardsaipersonalizedfirst
https://www.usb-flash-drive.ca/
Custom USB Flash Drives Personalized with Your Logo
Customize your own USB Flash Drive! Personalized and branded USB drives with your logo. Great selection and quality.
custom usb flash drivespersonalizedlogo
https://iterable.com/
AI Customer Engagement Platform for Real-Time, Personalized Experiences
Jun 4, 2026 - Iterable is an AI customer engagement platform built for how customers behave today, helping brands respond in real time with unified data and optimization.
ai customer engagementfor realplatformtimepersonalized
https://www.stress-balls.ca/
Promotional Stress Balls, Personalized Stress Toys and Squeeze Balls
Personalized Promotional Stress Ball and Stress Reliever in Canada.
promotional stress ballspersonalized toyssqueeze
https://dcsirish.schoolsplp.com/login
Log In | Personalized Learning Platform
personalized learninglogplatform
https://www.getnamenecklace.com/
Personalized Jewelry at Cheap Prices - GetNameNecklace
GetNameNecklace is the best online store to buy cheap personalized jewelry. Get your custom made jewelry today, worldwide FAST shipping!
personalized jewelrycheappricesgetnamenecklace
https://pej.my.id/
Personalized Elegance Journeys – Tailoring Home Designs
personalizedelegancejourneystailoringdesigns
https://pubmed.ncbi.nlm.nih.gov/37355891/
Observed Improvement in Cognition During a Personalized Lifestyle Intervention in People with...
Multiple measures of cognitive function improved after six months of intervention. Our results support the feasibility and impact of a multimodal,...
observedimprovementcognition
https://odesongs.com/
Personalized Song Gifts | Custom Songs in Minutes | Odesongs
Create a personalized song gift in minutes. Original lyrics, real vocals, built from your memories. Delivered in 2 minutes.
personalized song giftscustom songsminutes
https://mailmeteor.com/
Mailmeteor - Send personalized emails and manage replies at scale
Mailmeteor helps you send personalized emails and manage replies at scale. We power your email workflow with intuitive tools, that combines email productivity,...
personalized emailsmanage repliesmailmeteorsendscale
https://sano.science/
Sano - Centre for Computational Personalized Medicine
Jul 28, 2026 - Sano is a non-profit foundation advancing computational medicine to enhance global healthcare efficiency and effectiveness.
centre forsanocomputationalpersonalizedmedicine
https://www.centralms.dexafit.com/
DexaFit Central Mississippi | Personalized Health Insights with DEXA Scan, Metabolic & VO2 Max Tests
Transform your health with DexaFit in Central Mississippi. Our services include DEXA scans for precise body composition analysis, RMR testing for metabolic...
personalized health insights
https://cardzware.com/
Personalized Greeting Card App
Sep 26, 2023 - Cardzware is a print on demand personalized greeting card app that offers global production and delivery for Shopify and WooCommerce stores.
personalized greeting cardapp
https://brandedchargers.com/
Custom Chargers with Logo | Wholesale Personalized Chargers | BrandedChargers.com
with logocustomchargerswholesalepersonalized
https://humanizedhealth.com/
Humanized – Your Health Personalized
your healthhumanizedpersonalized
https://www.ascentutah.org/
K-9 charter school, Personalized Learning School Utah
Ascent Academies of Utah offers a tuition-free, K-9 charter school experience across 5 campuses in Utah, focusing on personalized learning for each student.
charter schoolpersonalized learningkutah
https://bitcoiner.guide/
Personalized Bitcoin Support
Take the guesswork out of interacting with Bitcoin.
personalizedbitcoinsupport
https://lutanen.com/
Personalized Concierge Care | Lutanen Health
Feb 20, 2026 - Physician-owned concierge medical practice in Boston with small patient panels, same-day access, and long-term care relationships.
concierge carepersonalizedhealth
https://doitmine.com/
DoItMine - Customize T-shirts & Wholesale Personalized Gifts
Mar 27, 2026 - Create custom T-shirts and personalized gifts online at Do It Mine. Design T-shirts and order bulk printed merchandise for businesses, events and promotions.
t shirtscustomizewholesalepersonalizedgifts
https://www.noromeal.com/
NoroMeal — Personalized Meal Plans for Your Goals
NoroMeal builds personalized weekly meal plans with calorie and macro targets based on your profile, body metrics, and food preferences. Create your meal plan.
personalized meal plansfor yournoromealgoals
https://www.customsunscreenstore.com/
Custom Sunscreen Store | Personalized Sunscreen in Bulk
Effectively promote your brand with a personalized sunscreen! It's an excellent giveaway featuring your custom logo. Buy at the Custom Sunscreen Store!
custom sunscreen storepersonalizedbulk
https://www.healthcareforyou.com/
Healthcare for You - Personalized Healthcare
Dec 10, 2020 - Your Health. Your Doctor. Your Wallet. Your Choice.
healthcare for youpersonalized
https://www.snapfish.com/home
Snapfish | Personalized Gifts, Cards, Home Decor, Photo Books & More
Design and send the best personalized gifts, cards, home decor, photo books, and prints with Snapfish.
personalized giftscards homephoto bookssnapfishdecor
https://support.apple.com/en-us/105131
Control personalized ads on the App Store, Apple News, and Stocks - Apple Support
Learn how to limit the personalization of ads delivered by Apple on your iPhone, iPad, iPod touch, and Mac, and how to turn off location-based ads delivered by...
ads on the app store
https://tourswithlocals.ch/
TourWithLocals – Discover Switzerland with Local Experts: Personalized Tours and Hidden Gems
discover switzerlandlocal experts
https://www.runna.com/
Runna | #1 rated personalized training plans for running
Runna is the world’s best running coaching app, making expert coaching affordable and accessible for everyone. Get started.
personalized trainingrunnaratedplansrunning
https://healthscores.ai/
healthscores.ai – Personalized Health Score & Secure Health Wallet
healthscores.ai connects your medical records, wearables, and family caregiving data to deliver one clear Health Score in a secure wallet you control.
personalized healthaiscoresecurewallet
https://www.teamefcoaching.com/
Personalized Cycling Coaching for Riders | Team EF Coaching
Get personalized cycling coaching built around your goals, schedule, and life, with WorldTour insight, expert coaches, and proven training support.
cycling coachingfor riderspersonalizedteamef
https://www.banque-es.ch/
Banque Eric Sturdza | Personalized Private Banking Solutions
private bankingbanqueericpersonalizedsolutions
https://funko.com/
Funko Official Store, Home of Pop! Vinyl, Personalized Pops! | Funko
Funko designs and sells unique pop culture collectibles, accessories, and toys.
official storepop vinylfunkopersonalizedpops
https://personalizedmarketing.info/
Personalized Marketing Inc – Customized Marketing and Website Services Since 2008
#PMInc has provided customized client services for over 10 years. Social Media Marketing, SEO, Website Design, Email Campaigns and more.
personalized marketing incwebsite servicescustomizedsince
https://southerndreamsdivingclub.com/
Diving Bali: Personalized Dive Trips & Courses in Candidasa
Apr 22, 2026 - Discover the best diving in Bali with Southern Dreams Diving Club: small groups, personalized dives, and top Bali dive sites.
dive tripsdivingbalipersonalizedcourses
https://www.groovygolfer.com/
Golf Gifts for Men | Personalized Golf Accessories & Gear
gifts for menpersonalized accessoriesgolfgear
https://area9lyceum.com/
Personalized adaptive learning in four dimensions | Area9 Lyceum
Mar 3, 2026 - The mission of Area9 Lyceum is to help deliver the world’s best educational and training outcomes validated by a long-term scientific approach.
adaptive learningpersonalizedfourdimensionslyceum
https://morphowebdesign.com/
Personalized Web Design & Marketing Solutions | Savannah GA.
web designmarketing solutionspersonalizedsavannahga
https://thiamineprotocols.com/b1-blueprint
Personalized Thiamine Protocol | B1 Blueprint Course
personalizedthiamineprotocolblueprintcourse
https://www.catamaran-net.com/
Catamaran net made in France and personalized
Aug 11, 2022 - Personalized catamaran net made in France. For the house or garden, relax in complete safety in your house net. Catamaran net for sailboats.
made in francecatamaranpersonalized
https://www.customsunglassstore.com/
Custom Sunglass Store | Buy Personalized Sunglasses Online
The Custom Sunglass Store offers promotional sunglasses at great prices! Buy personalized sunglasses online at customsunglassstore.com.
customsunglassstorebuypersonalized
https://dapralab.com/
DapraLab - Personalized Brand Solutions to Boost Growth & Engagement
DapraLab offers tailored solutions in branding, SEO, PPC, social media, and more. Build trust, boost engagement, and transform your brand with us. Get a free...
brand solutionsboost growthdapralabpersonalizedengagement
https://willowhive.com/
Personalized Home Gifts | Handcrafted in Monroe, CT | Willow & Hive
Shop personalized home gifts handcrafted in Monroe, Connecticut. Custom charcuterie boards, engraved glassware, blankets, home signs, and more. Free...
home giftsmonroe ctpersonalizedhandcraftedwillow
https://www.carolinadandy.com/
Personalized Canvas Tote Bags & Thoughtful Gifts | Carolina Dandy
Classic personalized canvas tote bags for gifting, celebrations, and everyday adventures. Custom embroidered totes for teachers, bridesmaids, graduates,...
canvas tote bagsthoughtful giftspersonalizedcarolinadandy
https://ashlandwebsites.com/
Ashland Websites. Personalized Website Design in Ashland, Oregon.
Aug 7, 2025 - Personalized website design services by David Gordon based in Ashland, Oregon. I build brochure sites, artist websites, and e commerce sties. I work with...
personalized websitedesign inashlandwebsitesoregon
https://gepl.beanstack.org/reader365
Beanstack: Reading Challenges and Personalized Recommendations
Beanstack is a platform for reading challenges and book recommendations for any organization, especially libraries and schools.
beanstack reading challengespersonalizedrecommendations
https://clarest.com/
Home | Personalized Medication Management | Clarest
Jun 9, 2026 - Clarest offers personalized medication management for patients in facilities and at home so they can live healthier and happier lives.
personalized medicationmanagement
https://prifinance.com/
Prifinance - personalized legal and corporate consulting for international business activities
Jul 14, 2026 - Prifinance is an international consulting company. We provide services in the field of international and tax planning, audit, law, as well as in the field of...
for international businesscorporate consultingpersonalizedlegalactivities
https://tshirtfly.com/
Custom & Personalized T Shirt Printing Dubai JLT & Abu Dhabi
Apr 5, 2026 - Design and personalize your own custom T-shirts, Hoodies, Baby Onesies, Caps, Mugs, Cushion gifts online and get it delivered all over UAE. T shirt Printing...
personalized t shirtcustomprintingdubaijlt
https://acustomcut.com/
A Custom Cut - Premium Custom Signs, Personalized Engraved Gifts, and Decor | A Custom Cut
A Custom Cut is a design studio specializing in custom made signs, decor, gifts, and event details. Designed and produced in San Diego, CA.
personalized engraved giftscustom cutpremiumsignsdecor
https://memorialplaques.ie/
Personalized Memorial Plaques, Memorial gifts and Grave memorials
Jul 8, 2024 - Choose a memorial plaque and personalize it for your loved one. Our memorial plaques make unique memorial gifts and graveside plaques for family and frien
memorial plaquespersonalizedgiftsgravememorials
https://maximatherapy.com/
Maxima Therapy | Personalized Support for Neurodivergent Individuals
Maxima Therapy provides compassionate, individualized programs for neurodivergent children, adults, and families, from early intervention to workforce and...
maxima therapypersonalized supportneurodivergentindividuals
https://classicfinancial.net/
Classic Financial - Financial Planning Personalized for You
Feb 5, 2026 - Classic Financial helps clients achieve their financial dreams by offering creative and personalized solutions through financial, insurance, and investment...
financial planningclassicpersonalized
https://digital.eguruzy.com/
eGuruzy Digital - India's Next-Gen Personalized Learning Platform
eGuruzy is India’s next-generation personalized learning, skill development and career growth platform designed to bridge the gap between education and...
digital indianext genpersonalized learningplatform
https://ailearna.com/
Learna AI – Improve Your English with Personalized AI Tutors
Boost your English skills with AI tutors. Learn, speak, and practice with Learna – your smart English learning companion.
improve your englishaipersonalizedtutors
https://geckocustom.com/
Custom Photo Gift, Personalized Photo Gift, Picture Print Gift
Unique custom gifts, Personalized gifts for dog lovers, campers, bestie, best friends, Custom photo gift, photo blanket, photo shirt, dog photo shirt, photo...
custom photogiftpersonalizedpictureprint
https://getselli.in/sales
Selli - Attract Attention With Hyper Personalized Images
Personalize your outreach messages, emails and landing pages for better end-to-end personalization and better results.
selliattractattentionhyperpersonalized
https://pictolamp.com/
Pic-To-Lamp – Your 3D Printed, Personalized Lamp
Your 3D Printed, Personalized Lamp
piclampprintedpersonalized
https://brandedcoolers.com/
Custom Coolers with Logo | Wholesale Personalized Coolers | BrandedCoolers.com
custom coolerswith logowholesalepersonalized
https://dtitrader.com/
Diversified Trading Institute | Trading Education | Trading education with a personalized focus
with adiversifiedtradinginstituteeducation
https://windroserecovery.com/
Discover the Path to Truly Personalized Addiction Treatment in the Midwest
Jun 22, 2026 - Windrose Recovery provides treatment to navigate the journey to wellness and break free from the cycle of substance use disorders.
discover theaddiction treatmentpathtrulypersonalized
https://the-personalized-web.digitale-grafik.com/
The Personalized Web
personalizedweb
https://merge.email/
Mail Merge for Gmail | Send personalized mass emails from Google Sheets
Send personalized mass emails directly from Gmail using a Google Sheet as your recipient list. Free for up to 50 emails per day. Trusted by millions on the...
mail merge for gmailmass emailsfrom googlesend