Robuta

https://mastodon.social/@gravitykit GravityKit (@gravitykit@mastodon.social) - Mastodon 174 Posts, 2 Following, 16 Followers ยท The best way to display, import, edit, and export Gravity Forms entries. gravitykitmastodonsocial https://www.gravitykit.com/ GravityKit - Powerful Gravity Forms add-ons May 6, 2026 - GravityKit is a leading developer of Gravity Forms add-ons, providing powerful tools for managing data and building web applications. gravity formsgravitykitpowerfuladdons https://www.gravitykit.dev/docs/gravityview/filters/gravityview-template-layout-builder-entry-class/ Filter - gravityview/template/layout-builder/entry/class | GravityKit Developer Documentation Modify the class applied to the entry row. layout builderfiltergravityviewtemplateentry https://www.gravitykit.com/docs/gravityview/filter-and-sort-results/sorting-by-multiple-columns/ Sorting by multiple columns - GravityKit multiple columnssortinggravitykit https://www.gravitykit.com/docs/gravityview/shortcodes/gv-entry-link/ The [gv_entry_link] Shortcode - GravityKit Apr 27, 2026 - The [gv_entry_link] shortcode generates view, edit, or delete links for specific entries, with security key and post ID parameters. gventryshortcodegravitykit https://www.gravitykit.dev/docs/gravityview/filters/gk-gravityview-search-number-range-step/ Filter - gk/gravityview/search/number-range/step | GravityKit Developer Documentation Modifies the step value for the input fields. filtergkgravityviewsearchnumber https://www.gravitykit.dev/docs/gravityview/filters/gravityview-field-other_entries-criteria/ Filter - gravityview/field/other_entries/criteria | GravityKit Developer Documentation Modify the search parameters before the entries are fetched. filtergravityviewfieldentriescriteria https://www.gravitykit.com/docs/gravityview/advanced/disable-code-editor/ Disable the Custom Content code editor - GravityKit Apr 24, 2026 - Turn off GravityView's CodeMirror editor on Custom Content fields by checking 'Syntax Highlighting' in your WordPress user profile settings. custom contentcode editordisablegravitykit https://www.gravitykit.dev/docs/gravityview/actions/gk-gravityview-template-before-field-render/ Action - gk/gravityview/template/before-field-render | GravityKit Developer Documentation Fires before a field of an item is rendered. actiongkgravityviewtemplatefield https://academy.gravitykit.com/lesson/wrap-up-4/ Wrap Up - GravityKit Academy Aug 1, 2020 - In this course we created a form to collect known domain names for our members companies. Next, we installed a snippet to pull the domain name from an wrap upgravitykitacademy https://www.gravitykit.com/docs/gravityview/exporting-entries-with-fields-not-displayed-in-the-view/ Exporting entries with fields not displayed in the View - GravityKit Apr 27, 2026 - Create an export-only View with all desired fields, enable 'Allow Export' in Permissions, then link to its /csv/ URL from your main View. in theexportingentriesfieldsdisplayed https://academy.gravitykit.com/course/how-to-add-an-export-data-link-button-to-a-view/ How to add an "Export Data" link/button to a View - GravityKit Academy In this video Casey gives a demo on how to export data from a View using the new "Export Link" widget in the View editor. how to addexport data https://www.gravitykit.com/docs/gravityview/merge-tags/merge-tag-modifiers/ GravityView Merge Tag modifiers - GravityKit Apr 27, 2026 - GravityView adds merge tag modifiers for string formatting, case changes, URL encoding, name initials, date formatting, and multi-value field output. gravityviewmergetagmodifiersgravitykit https://www.gravitykit.dev/docs/gravityview/since/1-17/ 18 docs tagged with "1.17" | GravityKit Developer Documentation docstaggedgravitykitdeveloperdocumentation https://www.gravitykit.com/docs/gravityedit/inline-edit-column-edit-mode-bulk-editing/ GravityEdit: Column Edit mode (bulk editing) - GravityKit Apr 27, 2026 - Click a column header in the Gravity Forms Entries list to enter GravityEdit's Column Edit mode and update that field's values across multiple entries. edit modebulk editinggravityeditcolumngravitykit https://www.gravitykit.com/for/ Find Out if GravityKit Is Right for You - GravityKit Nov 25, 2025 - GravityKit can solve your problems! It doesn't matter if you're a state university, a marketing agency, or simply an individual developer. find outgravitykitright https://www.gravitykit.dev/docs/gravityview/filters/gravityview-template-field-output/ Filter - gravityview/template/field/output | GravityKit Developer Documentation Modify the field output for a field. filtergravityviewtemplatefieldoutput https://www.gravitykit.com/docs/gravityview/filter-and-sort-results/forcing-numbers-to-sort-properly/ Forcing numbers to sort properly - GravityKit Apr 27, 2026 - Use the gk/gravityview/view/entries/query/sorting-parameters filter to force GravityView to sort text dropdown fields as numeric values. forcingnumberssortproperlygravitykit https://www.gravitykit.com/how-to-build-a-rental-property-management-system-on-wordpress-using-gravitykit/ How to build a rental property management system on WordPress using GravityKit - GravityKit Apr 29, 2026 - In this tutorial, I'll show you how to build a fully functional rental property management system right inside WordPress using Gravity Forms and GravityKit.... how to buildrental property management https://www.gravitykit.dev/docs/gravityview/filters/gravityview-extension-search-links_label/ Filter - gravityview/extension/search/links_label | GravityKit Developer Documentation Changes the label for the "Link" search bar input type. search linksfiltergravityviewextensionlabel https://academy.gravitykit.com/lesson/dashboard-views/ Dashboard Views - GravityKit Academy dashboardviewsgravitykitacademy https://www.gravitykit.com/docs/gravityview/common-problems/infinite-loop/ Infinite loop recursion - GravityKit Apr 24, 2026 - A [gravityview] shortcode inside the same View creates a recursive loop that can crash the server. Clone the View and embed the clone instead to avoid it. infinite looprecursiongravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview-search-input_types/ Filter - gravityview/search/input_types | GravityKit Developer Documentation Change the types of search fields available to a field type. search inputfiltergravityviewtypesgravitykit https://automatorplugin.com/connect/gravitykit/wp-download-manager/ Connect GravityKit to WordPress Download Manager - Uncanny Automator Connect GravityKit to WordPress Download Manager with Uncanny Automator using a simple, powerful UI and no code. Try it free! wordpress download managerconnectgravitykituncannyautomator https://www.gravitykit.com/docs/gravityview/customizing-your-views/ Customizing Your Views Archives - GravityKit Customize GravityView appearance: CSS, conditional fields, image sizes, date formats, lightboxes, responsive layouts, and more. your viewscustomizingarchivesgravitykit https://automatorplugin.com/connect/schedule/gravitykit/ Connect Schedule to GravityKit - Uncanny Automator Connect Schedule to GravityKit with Uncanny Automator using a simple, powerful UI and no code. Try it free! connectschedulegravitykituncannyautomator https://www.gravitykit.dev/docs/gravityview/filters/gravityview-widgets-register/ Filter - gravityview/widgets/register | GravityKit Developer Documentation Each item is used to instantiate a GravityViewAdminView_Widget object. filtergravityviewwidgetsregistergravitykit https://www.gravitykit.com/how-to-create-a-dynamic-careers-page-on-wordpress-using-gravitykit/ How to create a dynamic careers page on WordPress using GravityKit - GravityKit Apr 29, 2026 - Build a dynamic Careers page in WordPress using Gravity Forms and GravityView. Learn how to create job listings, application forms, and admin dashboards... how to createcareers pagedynamic https://www.gravitykit.com/docs/gravityview-pro/multiple-forms/multiple-forms-strict-match/ Multiple Forms: How the "Strict Entry Match" setting works - GravityKit Strict Entry Match hides parent form rows that have no matching records in every connected form, showing only fully matched entries. multipleformsstrictentrymatch https://www.gravitykit.com/academic-journal-on-wordpress/ How to create an academic journal on WordPress without code - GravityKit May 7, 2026 - Create an academic journal on WordPress with no coding needed! Learn to manage submissions, reviews, and publish research papers easily. how to createacademic journalwithout code https://www.gravitykit.com/docs/gravityview/getting-started-gravityview/page/2 View Setup Archives - GravityKit Build GravityView Views from scratch: choose a layout, add fields, embed with blocks or shortcodes, and configure edit and delete entry. view setuparchivesgravitykit https://www.gravitykit.com/case-study/national-severe-storms-lab/ NSSL - GravityKit May 4, 2026 - How GravityKit powers staff profiles for the National Severe Storms Laboratory The National Severe Storms Laboratory (NSSL) modernized internal data access... gravitykit https://www.gravitykit.dev/docs/gravitycalendar/api/classes/gravitykit-gravitycalendar-gutenberg-blocks/ GravityKit\GravityCalendar\Gutenberg\Blocks | GravityKit Developer Documentation GravityCalendar blocks. gutenberg blocksgravitykitgravitycalendardeveloperdocumentation https://automatorplugin.com/connect/wp-bitly/gravitykit/ Connect WP Bitly to GravityKit - Uncanny Automator Connect WP Bitly to GravityKit with Uncanny Automator using a simple, powerful UI and no code. Try it free! wp bitlyconnectgravitykituncannyautomator https://automatorwp.com/add-ons/gravity-kit/ GravityKit - AutomatorWP Sep 26, 2025 - Connect AutomatorWP with GravityKit gravitykitautomatorwp https://gravitycalendar.try.gravitykit.com/ GravityKit โ€“ GravityCalendar demo โ€“ See if GravityCalendar is right for you gravitykitgravitycalendardemoseeright https://www.gravitykit.com/docs/gravitycharts/how-to-embed-charts-on-your-website/ How to Embed Charts on Your Website - GravityKit Apr 24, 2026 - GravityCharts charts embed via the GravityCharts block, the [gravitycharts] shortcode, or as a static image using the Image Charts embed_type attribute. how to embedon your websitechartsgravitykit https://www.gravitykit.com/docs/gravityexport/styling-pdf-files/ Styling PDF file exports using CSS - GravityKit Apr 27, 2026 - GravityExport builds PDF exports from an HTML table, letting you style rows and columns with CSS selectors to control fonts, colors, and layout. pdf filestylingexportsusingcss https://www.gravitykit.com/docs/uncategorized/add-gravitykit-support-emails-to-your-allowlist/ Adding GravityKit support emails to your allowlist - GravityKit Add GravityKit support addresses to your email allowlist so replies from our team aren't filtered as spam before they reach your inbox. addinggravitykitsupportemailsallowlist https://www.gravitykit.dev/docs/gravityview/actions/gk-gravityview-admin-views-view-after-zone/ Action - gk/gravityview/admin-views/view/after-zone | GravityKit Developer Documentation Allows additional content after the zone was rendered. admin viewsactiongkgravityview https://www.gravitykit.com/docs/gravity-forms-event-field/configuring-the-gravity-forms-event-field/ Getting started with the Gravity Forms Event field - GravityKit Apr 27, 2026 - The Gravity Forms Event field bundles start date, end date, all-day toggle, and repeat settings into a single field designed for GravityCalendar. getting started withgravity formseventfieldgravitykit https://www.gravitykit.com/docs/gravityview-pro/multiple-forms/how-to-connect-two-forms-using-the-nested-forms-field-with-the-multiple-forms/ How to connect two forms using the Nested Forms field with the Multiple Forms - GravityKit Map the parent Entry ID to the child form's Parent Entry ID in Multiple Forms to display GravityWiz Nested Forms data in a single View. how to connect https://www.gravitykit.dev/docs/gravityexport-lite/since/2-6-0/ One doc tagged with "2.6.0" | GravityKit Developer Documentation onedoctaggedgravitykitdeveloper https://www.gravitykit.com/docs/gravityview/faq/can-i-display-multiple-views-on-the-same-page/ Can I display multiple Views on the same page? - GravityKit Apr 24, 2026 - Multiple Views on the same page work by adding separate [gravityview] shortcodes. Avoid placing two DataTables Views on the same page to prevent conflicts. on the same pagemultiple viewsdisplaygravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview_render_after_label/ Filter - gravityview_render_after_label | GravityKit Developer Documentation Append content to a field label. filtergravityviewrenderlabelgravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview-view-anchor_id/ Filter - gravityview/view/anchor_id | GravityKit Developer Documentation Modify the anchor ID. filtergravityviewanchoridgravitykit https://www.gravitykit.dev/docs/gravityview/since/1-17-2/ 2 docs tagged with "1.17.2" | GravityKit Developer Documentation docstaggedgravitykitdeveloperdocumentation https://www.gravitykit.dev/docs/gravityview/actions/gravityview-edit_entry-after_update/ Action - gravityview/edit_entry/after_update | GravityKit Developer Documentation Perform an action after the entry has been updated using Edit Entry. edit entryactiongravityviewupdategravitykit https://www.gravitykit.dev/docs/gravityview/api/classes/gv-entry_sort/ GV\Entry_Sort | GravityKit Developer Documentation gventrysortgravitykitdeveloper https://www.gravitykit.dev/docs/gravityview/filters/gk-gravityview-admin-views-rows-actions/ Filter - gk/gravityview/admin-views/rows-actions | GravityKit Developer Documentation Modifies the actions rendered in the View editor. admin viewsfiltergkgravityviewrows https://www.gravitykit.com/docs/gravityview-pro/advanced-filter/advanced-filters-upgrade/ (Advanced) What changed from 1.x to 2.0? - GravityKit Apr 24, 2026 - Advanced Filtering 2.0 switches to the gravityview/view/query filter for GF_Query manipulation, rewrites the UI in Svelte, and adopts a new filter schema. advancedchangedxgravitykit https://www.gravitykit.com/docs/gravityview-pro/maps-premium-view/hide-map-elements-using-css/ How to hide map elements using CSS - GravityKit Apr 27, 2026 - CSS snippets to individually hide the redo-search checkbox, fullscreen button, pan controls, zoom buttons, street view pegman, and scale bar. how tohide mapelementsusingcss https://www.gravitykit.com/docs/gravityview/common-problems/gravityview-updates-arent-displaying/ GravityView updates aren't displaying - GravityKit Apr 27, 2026 - Missing GravityView update notices are usually caused by an inactive license, a wrong activation domain, or WordPress not yet checking for new versions. gravityviewupdatesdisplayinggravitykit https://www.gravitykit.com/top-6-best-responsive-table-plugins-for-wordpress/ Top 6 best responsive table plugins for WordPress - GravityKit Apr 29, 2026 - Discover the top responsive WordPress table plugins, including GravityView, WP Table Builder, and wpDataTables. plugins for wordpressresponsive tabletopbestgravitykit https://www.gravitykit.com/editing-entries-in-gravity-forms/ Pillar page โ€“ Editing entries in Gravity Forms - GravityKit Apr 24, 2026 - Wondering how to edit entries in Gravity Forms? Here's everything you need to know including editing Gravity Forms entries on the front end. gravity formspillareditingentriesgravitykit https://www.gravitykit.com/docs/gravityview/customizing-your-views/adding-custom-css-to-your-website/ Adding custom CSS to your Views - GravityKit Apr 27, 2026 - Write CSS in the Custom Code tab of View Settings so styles load only on that View's page; use VIEW_SELECTOR to scope rules to the current View. custom cssyour viewsaddinggravitykit https://www.gravitykit.com/exporting-data-from-gravity-forms/ Exporting Data From Gravity Forms: A Complete Guide - GravityKit Apr 24, 2026 - This guide covers every major export format, automation option, and integration available for Gravity Forms, with links to detailed tutorials for each. exporting datagravity formscomplete guidegravitykit https://www.gravitykit.dev/docs/gravityforms/actions/gform_state_pre_encode/ Action - gform_state_pre_encode | GravityKit Developer Documentation This hook supports dynamic naming with the following modifiers: actionstatepreencodegravitykit https://automatorplugin.com/connect/gravitykit/caldera-forms/ Connect GravityKit to Caldera Forms - Uncanny Automator Connect GravityKit to Caldera Forms with Uncanny Automator using a simple, powerful UI and no code. Try it free! caldera formsconnectgravitykituncannyautomator https://www.gravitykit.com/docs/gravityview/common-problems/only-some-users-are-visible-the-change-entry-creator-dropdown/ Only some users are visible the Change Entry Creator dropdown - GravityKit Apr 25, 2026 - GravityView caps the Change Entry Creator dropdown at 2,000 users by default. Install the provided plugin to remove that limit on sites with more users. the changeusersvisible https://www.gravitykit.dev/docs/gravityview/filters/gravityview-edit_entry-unset_hidden_field_values/ Filter - gravityview/edit_entry/unset_hidden_field_values | GravityKit Developer Documentation Whether to delete values of fields hidden by conditional logic. edit entryfiltergravityviewunset