Robuta

https://www.gravitykit.dev/docs/gravityforms/since/2-4/ 25 docs tagged with "2.4" | GravityKit Developer Documentation docstaggedgravitykitdeveloperdocumentation https://www.gravitykit.com/docs/gravityexport/gravityexport-field-listfield/ GravityExport field: ListField - GravityKit GravityExport combines Gravity Forms List field rows and columns into one or more cells, using soft returns to separate multiple values per entry. gravityexportfieldgravitykit https://www.gravitykit.com/docs/gravityview-pro/datatables/datatables-setting-save-table-state/ DataTables Setting: Save Table State - GravityKit Apr 24, 2026 - Save Table State persists pagination, sorting, and filters in the browser. Disable it in the DataTables tab if your View loads with incorrect sort order. datatablessettingsavestategravitykit https://automatorplugin.com/connect/gravitykit/divi/ Connect GravityKit to Divi - Uncanny Automator Connect GravityKit to Divi with Uncanny Automator using a simple, powerful UI and no code. Try it free! connectgravitykitdiviuncannyautomator https://automatorplugin.com/connect/gravitykit/gamipress/ Connect GravityKit to GamiPress - Uncanny Automator Connect GravityKit to GamiPress with Uncanny Automator using a simple, powerful UI and no code. Try it free! connectgravitykitgamipressuncannyautomator https://www.gravitykit.com/docs/gravityview/edit-entry/hiding-the-confirm-email-field-on-the-edit-entry-page/ Hiding the Confirm Email field on the Edit Entry page - GravityKit Apr 27, 2026 - Use the gravityview/edit_entry/form_fields filter to disable the confirmation email sub-field on the Edit Entry page for a specific View ID. confirm emailedit entryhidingfieldgravitykit https://www.gravitykit.com/docs/gravityview-pro/maps-premium-view/associating-a-custom-map-pin-icon-marker-with-a-field-value/ Associating a custom map pin icon (marker) with a field value - GravityKit Apr 24, 2026 - Check 'Use field choices as map marker icons' on a Drop Down or Radio Buttons field, set icons per choice, then select it in Maps settings. a custommap pinassociating https://www.gravitykit.com/docs/gravityview/search/configuring-the-search-bar/ Configuring the Search Bar widget - GravityKit Apr 24, 2026 - The Search Bar widget supports multi-row layouts, draggable fields, per-column settings, an Advanced Search drawer, and a freely positioned Submit Button. the searchconfiguringbarwidgetgravitykit https://www.gravitykit.com/docs/gravityview/common-problems/why-are-my-entries-not-visible/ Why View entries may not be showing up - GravityKit Apr 24, 2026 - GravityView entries can vanish on the front end due to a missing shortcode secret, no fields added, an empty form preset, approval filters, or field logic. view entriesshowing upmaygravitykit https://www.gravitykit.com/docs/gravityexport/reprocess-gravityexport-feed/ How to re-run a GravityExport Save feed - GravityKit Re-run a GravityExport Save feed by clicking the Process link on a single feed, or use the bulk actions dropdown to reprocess multiple feeds at once. how torungravityexportsavefeed https://www.gravitykit.dev/docs/gravitycalendar/filters/ Filters | GravityKit Developer Documentation GravityCalendar filters filtersgravitykitdeveloperdocumentation https://www.gravitykit.com/docs/gravitymath/math-shortcode/ The [gravitymath] Shortcode - GravityKit Apr 27, 2026 - [gravitymath] runs pure math or Gravity Forms entry aggregations anywhere on your site, with scope, filter, and format parameters for precise control. gravitymathshortcodegravitykit https://www.gravitykit.dev/docs/gravityforms/since/1-9-15-12/ One doc tagged with "1.9.15.12" | GravityKit Developer Documentation onedoctagged https://www.gravitykit.com/docs/gravityexport/change-the-file-format-by-adding-the-file-extension-to-the-url/ Changing the File Format of a Report by Adding the File Extension to the URL - GravityKit Apr 24, 2026 - Append .pdf, .csv, or .xlsx to any GravityExport download URL to change the output file format without modifying the feed settings. the file format https://www.gravitykit.com/version-1-7-is-released/ GravityView 1.7 Supports Editing Post Content - GravityKit Apr 24, 2026 - GravityView now supports editing post fields! In previous versions of GravityView (and in Gravity Forms itself), if you wanted to edit Post Fields, you post contentgravityviewsupportseditinggravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview-tooltips-tooltip/ Filter - gravityview/tooltips/tooltip | GravityKit Developer Documentation Modify the tooltip HTML before outputting. filtergravityviewtooltipsgravitykitdeveloper https://www.gravitykit.com/docs/gravityview/customizing-your-views/adding-a-percent-sign-to-a-column/ Adding a percent sign (%) to a column - GravityKit Display a percent sign next to field values by adding a Custom Content field and inserting the field's merge tag followed by a % character. addingpercentsigncolumngravitykit https://www.gravitykit.com/docs/gravityview/getting-started-gravityview/the-entry-notes-field/ The Entry Notes field - GravityKit Apr 25, 2026 - The Entry Notes field displays Gravity Forms admin notes on the front end. Field settings control who can view, add, or email notes from the View. entrynotesfieldgravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview_lightbox_script/ Filter - gravityview_lightbox_script | GravityKit Developer Documentation Override the lightbox script to enqueue. Default: thickbox. filtergravityviewlightboxscriptgravitykit https://www.gravitykit.dev/docs/gravityview/filters/gravityview-field_output-pre_html/ Filter - gravityview/field_output/pre_html | GravityKit Developer Documentation Allow Pre filtering of the HTML. filtergravityviewfieldoutputpre https://www.gravitykit.dev/docs/gravityforms/since/2-1-1-20/ One doc tagged with "2.1.1.20" | GravityKit Developer Documentation onedoctaggedgravitykitdeveloper https://www.gravitykit.com/docs/gravityview-pro/datatables/the-text-inside-a-column-is-going-out-of-the-screen/ The text inside a column is going out of the screen - GravityKit Apr 27, 2026 - Fix text overflowing DataTables columns by adding white-space: pre-line to .gv-datatables-container tr.child p in your theme's CSS stylesheet. the texta columngoing outinside https://www.gravitykit.com/docs/gravityview/common-problems/display-issues-with-the-search-bar/ Display issues with the Search Bar - GravityKit Apr 27, 2026 - A horizontal Search Bar displaying vertically needs a -webkit-flex CSS fix or the gravityview_use_legacy_search_style filter to restore proper layout. the searchdisplayissuesbargravitykit https://www.gravitykit.com/docs/gravityimport/importing-post-fields/ Importing Gravity Forms Post Fields from CSV - GravityKit Apr 24, 2026 - GravityImport 2.0 removed Post Field support; use an Advanced Post Creation feed enabled on the Configure step to create WordPress posts during import. gravity formsimportingpostfieldscsv https://www.gravitykit.com/docs/gravityview/advanced/created-by-text-search/ How to change what fields are searched by the Search Bar "Created By" text input. - GravityKit Apr 27, 2026 - The Search Bar Entry Creator field matches display name, username, email, and nickname. Use a filter to restrict or expand which user fields are searched. https://www.gravitykit.dev/docs/gravityview/filters/gravityview_anchor_text_stripwww/ Filter - gravityview_anchor_text_stripwww | GravityKit Developer Documentation Strip www from the domain? anchor textfiltergravityviewgravitykitdeveloper https://www.gravitykit.com/docs/gravityview/faq/can-i-use-gravityview-to-edit-custom-post-types/ Can I use GravityView to edit Custom Post Types? - GravityKit Apr 24, 2026 - GravityView can edit Custom Post Types created with the Gravity Forms CPT plugin. CPTs from the Advanced Post Creation add-on are not yet editable. can i usecustom post typesgravityvieweditgravitykit https://www.gravitykit.dev/ GravityKit Developer Documentation Comprehensive developer documentation for all GravityKit products gravitykitdeveloperdocumentation https://automatorplugin.com/connect/gravitykit/github/ Connect GravityKit to GitHub - Uncanny Automator Connect GravityKit to GitHub with Uncanny Automator using a simple, powerful UI and no code. Try it free! connectgravitykitgithubuncannyautomator https://www.gravitykit.com/docs/gravityview/customizing-your-views/adding-a-link-to-a-column/ Adding a link to a column - GravityKit Place a merge tag inside a Custom Content field to turn a name or any column into a clickable link using a URL or email address from another form field. a linkaddingcolumngravitykit https://www.gravitykit.dev/docs/gravityforms/actions/gform_pre_handle_confirmation/ Action - gform_pre_handle_confirmation | GravityKit Developer Documentation Fires during submission before the confirmation is processed. actionprehandleconfirmationgravitykit https://www.gravitykit.dev/docs/gravityview/api/classes/gv-view_collection/ GV\View_Collection | GravityKit Developer Documentation A collection of \GV\View objects. view collectiongvgravitykitdeveloperdocumentation https://www.gravitykit.com/docs/gravityview-pro/diy-layout/showing-before-and-after-content-even-when-field-is-empty/ Showing Before and After Content even when field is empty - GravityKit Apr 27, 2026 - Add the gravityview-diy/field-value/show-settings-content-if-empty filter to display Before/After Content sections even when the field value is empty. before and aftershowingcontent https://www.gravitykit.com/docs/uncategorized/gravityboard-gravityview-integration/ GravityBoard + GravityView Integration - GravityKit Apr 24, 2026 - GravityBoard's GravityView integration lets you open, view, and edit kanban card entries in a GravityView layout directly from your board interface. gravityboardgravityviewintegrationgravitykit https://www.gravitykit.dev/docs/gravityview/actions/gravityview-template-list-body-before/ Action - gravityview/template/list/body/before | GravityKit Developer Documentation Fires inside the body of the list, before any entries are rendered. actiongravityviewtemplatelistbody https://www.gravitykit.com/docs/gravityboard/gravityboard-voting-guide/ GravityBoard Voting Guide - GravityKit GravityBoard Voting adds upvote and downvote buttons to cards. Configure per-user vote budgets, reset periods, lane restrictions, and sort by vote count. voting guidegravityboardgravitykit https://www.gravitykit.com/docs/gravityview-pro/diy-layout/diy-layout-remove-the-back-link/ DIY Layout: Remove the "Go back" link - GravityKit Apr 27, 2026 - Remove the "Go back" link from DIY Layout single entry pages by hooking into gravityview/template/before and removing the back_link action callback. the goback linkdiylayoutremove https://www.gravitykit.com/docs/gravityedit/quickly-edit-entries-in-gravity-forms/ Getting started with GravityEdit - GravityKit Apr 27, 2026 - Enable Inline Edit in Form Settings, then click Toggle Inline Edit on the Entries page to start editing field values in place without opening each entry. getting startedgravityeditgravitykit https://www.gravitykit.com/docs/gravityview-pro/dashboard-views/getting-started-with-dashboard-views/ Getting started with Dashboard Views - GravityKit Apr 27, 2026 - Dashboard Views embeds GravityView Views in the WordPress admin, with role-based access controls, a custom menu label, and selectable stylesheets. getting starteddashboardviewsgravitykit https://www.gravitykit.dev/docs/gravityview/api/classes/gravityview_field_notes/ GravityView_Field_Notes | GravityKit Developer Documentation field notesgravityviewgravitykitdeveloperdocumentation https://automatorplugin.com/connect/gravitykit/getresponse/ Connect GravityKit to GetResponse - Uncanny Automator Connect GravityKit to GetResponse with Uncanny Automator using a simple, powerful UI and no code. Try it free! connectgravitykitgetresponseuncannyautomator https://www.gravitykit.com/docs/gravityview/advanced/about-gravityview-caching/ About GravityView Caching - GravityKit Apr 27, 2026 - GravityView caches entry queries per unique request to reduce database load; append ?cache to a View URL to bypass the cache and fetch fresh data. gravityviewcachinggravitykit https://www.gravitykit.dev/docs/gravityview/actions/gravityview-template-before/ Action - gravityview/template/before | GravityKit Developer Documentation Prepend content to the View. actiongravityviewtemplategravitykitdeveloper https://www.gravitykit.com/docs/gravityexport/gravityexport-field-fileuploadfield/ GravityExport field: FileUploadField - GravityKit Apr 27, 2026 - Use the gfexcel_field_fileuploads_enabled filter to exclude file upload fields from GravityExport downloads, or disable them in General Settings. gravityexportfieldgravitykit