https://www.neha.org/jeh/past-issues/custitem_rsm_sca_journal_column_facet/Direct-from-CDC,President%27s-Message/custitem_rsm_sca_readiness_facet/health-impacts,jeh-advertising
Journal Column: Direct-from-CDC, President%27s-Message, Readiness: health-impacts, jeh-advertising
health impactsjournalcolumndirectcdc
https://www.alleghenyfront.org/tracking-the-health-impacts-of-c8-exposure/embed/
Tracking the Health Impacts of C8 Exposure - The Allegheny Front
health impactsallegheny fronttrackingexposure
https://www.ijpr.org/northwest-environmental-news/2013-10-09/oregon-counties-plan-for-the-health-impacts-of-climate-change
Oregon Counties Plan For The Health Impacts Of Climate Change | Jefferson Public Radio
Oct 9, 2013 - Climate models predict hotter summers and wetter winters in the Northwest. Health officials in six Oregon counties are preparing for the health impacts that...
for thehealth impactsclimate changepublic radiooregon
https://www.civilianexposure.org/the-army-contaminates-fort-ord-region-with-pfas-and-downplays-health-impacts/
The Army Contaminates Fort Ord Region with PFAS and Downplays Health Impacts
Aug 23, 2024 - The Army has revealed that two highly toxic chemicals, PFOS and PFOA were recently found in the groundwater at the old Fort Ord, near Salinas, California at...
the armyhealth impactsfortordregion
https://vbn.aau.dk/da/publications/accounting-for-nutrition-related-health-impacts-in-food-life-cycl/
Accounting for nutrition-related health impacts in food life cycle assessment: insights from an...
life cycle assessmenthealth impactsaccountingnutritionrelated
https://www.quicknews.co.za/2023/07/07/foetal-exposure-to-thc-could-lead-to-long-lasting-health-impacts/
Foetal Exposure to THC could Lead to Long-lasting Health Impacts - Quicknews
Jul 7, 2023 - Consuming THC (Delta-9-tetrahydrocannabinol) while pregnant could potentially affect development of the foetus and lead to life-long health impacts for...
long lastinghealth impactsexposurethccould
https://pubmed.ncbi.nlm.nih.gov/37380613/
The implementation and public health impacts of cannabis legalization in Canada: a systematic review
Legalization of cannabis in Canada appears to have reduced cannabis arrests and increased access to a variety of more potent cannabis products at lower prices....
public health impactscannabis legalizationin canadasystematic reviewimplementation
https://msh.org/story/strengthening-leadership-and-management-for-sustainable-health-impacts/
Strengthening Leadership and Management for Sustainable Health Impacts - Management Sciences for...
Apr 5, 2022 - Strengthening Leadership and Management for Sustainable Health Impacts by Dr Mamitiana Ramanantsoa and Misa Rahantason Read this story in French Strong
leadership and managementhealth impactsstrengtheningsustainablesciences
https://healthebay.org/ddt-petition-2025/
Petition: Investigate Health Impacts of Southern California Offshore DDT Dumpsite - Heal the Bay
Mar 10, 2025 - State Water Resources Control Board: Investigate Health Impacts of Southern California Offshore DDT Dumpsite We, the undersigned, urge the State Water...
heal the bayhealth impactssouthern californiapetitioninvestigate
https://www.kiro7.com/news/local/some-doctors-say-daylight-saving-time-changes-have-negative-health-impacts/928653738/
Some doctors say Daylight Saving Time changes have negative health impacts - KIRO 7 News Seattle
daylight saving timenegative health impactsdoctorssaychanges
https://infinitylearn.com/surge/chemistry/cobalt-chemical-element/
Cobalt - Chemical Element, Characteristics, Occurrence, Applications, and Health Impacts - Infinity...
Apr 1, 2022 - Learn about cobalt - chemical element topic of chemistry in details explained by subject experts on infinitylearn.com. Register free for online tutoring...
applications andhealth impactscobaltchemicalelement
https://www.wtkr.com/2019/06/10/parkland-counselor-speaks-on-possible-mental-health-impacts-from-virginia-beach-shooting
Parkland counselor speaks on possible mental health impacts from Virginia Beach shooting
Jun 10, 2019 - What kind of impact can a traumatic experience, like a mass shooting, leave on the people who survived? A counselor for Parkland survivors weighs in.
mental healthvirginia beachparklandcounselorspeaks
https://www.racgp.org.au/clinical-resources/clinical-guidelines/key-racgp-guidelines/national-guide/health-impacts-of-climate-change
RACGP - Chapter 21 | Health impacts of climate change
Around the world, communities are experiencing rising sea levels and more dangerous, unpredictable and frequent extreme weather due to anthropogenic global...
health impactsclimate changeracgpchapter
https://uwspace.uwaterloo.ca/items/2205c84f-bd33-4f8e-af82-1673691aa0c8
Satellite-based PM2.5 Exposure Estimation and Health Impacts over China
Exposure to suspended fine particulate matter (PM2.5) has been proven to adversely impact public health through increased risk of cardiovascular and...
health impactsover chinasatellitebasedexposure
https://khazna.ku.ac.ae/en/publications/noise-pollution-and-other-environmental-and-health-impacts-of-avi/
Noise Pollution and Other Environmental and Health Impacts of Aviation - Khalifa University
noise pollutionenvironmental healthimpactsaviationkhalifa
https://researchconnect.stonybrook.edu/en/publications/covid-19-related-medical-mistrust-health-impacts-and-potential-va/
COVID-19 Related Medical Mistrust, Health Impacts, and Potential Vaccine Hesitancy Among Black...
health impactsvaccine hesitancycovidrelatedmedical
https://www.insightsonindia.com/2026/04/08/groundwater-pollution/
Groundwater Pollution in India: Causes, Health Impacts, Data & Solutions
Apr 8, 2026 - Groundwater pollution in India affects thousands of villages. Learn causes, contamination data, health risks, and solutions for safe water management.
health impactsdata solutionsgroundwaterpollutionindia
https://www.dentalcare.com/en-us/ce-courses/ce694/health-impacts-of-hidden-sugars
Health Impacts of Hidden Sugars - The Truth about Hidden Sugars: A Risk for Health - Dentalcare
health impactshidden sugarsthe truthrisk
https://www.innerscene.com/health-impacts
Health Impacts by Innerscene Artificial Skylights & Windows
Discover Innerscene's cutting-edge artificial skylight products, the Virtual Sun and Circadian Sky, designed to simulate natural daylight and enhance circadian...
health impactsartificialskylightswindows
https://www.pecva.org/work/energy-work/data-centers/new-study-highlights-public-health-impacts-of-gas-turbine-powered-data-centers/
New Study Highlights Public Health Impacts of Gas Turbine-Powered Data Centers - The Piedmont...
May 6, 2026 - As data centers requiring more and more power continue to flood our region, we are seeing a concerning new trend: data center proposals that include onsite...
public health impactsnew studygas turbinedata centershighlights
https://scholars.hkbu.edu.hk/en/publications/estimates-of-health-impacts-and-radiative-forcing-in-winter-haze--2/
Estimates of Health Impacts and Radiative Forcing in Winter Haze in Eastern China through...
health impactsradiative forcingestimateswinterhaze
https://impacts.ucar.edu/en/publications/understanding-human-health-impacts-of-tropical-cyclones-across-sc/
Understanding human health impacts of tropical cyclones across scales - Impacts @ NSF NCAR and UCAR
human healthtropical cyclonesunderstandingimpactsacross
https://aging.jmir.org/2021/1/e25779/
JMIR Aging - Health Impacts of the Stay-at-Home Order on Community-Dwelling Older Adults and How...
Background: As of March 2021, in the USA, the COVID-19 pandemic has resulted in over 500,000 deaths, with a majority being people over 65 years of age. Since...
stay at homeaging healthon communityolder adultsjmir
https://diabeticlens.com/are-fruit-smoothie-bowls-too-high-in-sugar/
Are Fruit Smoothie Bowls Too High in Sugar? Examining Nutritional Facts and Health Impacts |...
Sep 20, 2025 - Fruit smoothie bowls seem healthy, but a lot of them are loaded with sugar. Most of that sugar sneaks in from fruits, fruit juices, and...
fruit smoothietoo highnutritional factshealth impactsbowls
https://publichealthpost.org/environment/do-americans-know-the-health-impacts-global-warming/
Do Americans Know the Health Impacts of Global Warming? - Public Health Post
May 13, 2024 - The majority of Americans believe that global warming is real, but fewer understand the impact of global warming on health.
health impactsglobal warmingamericansknowpublic
https://today.umd.edu/5-tips-treat-mental-health-impacts-crisis-a794fc83-c670-4b70-b7ea-db3bd6d60ad6
5 Tips to Treat the Mental Health Impacts of a Crisis | Maryland Today
Sep 27, 2025 - Counseling Center Director Recommends Ways to Address Anxiety and Isolation
mental healthtipstreatimpactscrisis
https://www.oanahealth.com/post/how-gut-health-impacts-pcos-symptoms
How Gut Health Impacts PCOS Symptoms - Oana - Posts
Explore how gut health influences PCOS symptoms and discover effective strategies for managing hormonal balance, inflammation, and insulin resistance.
gut healthpcos symptomsimpactsoanaposts
https://business.wisc.edu/news/new-research-from-wisconsin-school-of-business-highlights-severe-economic-and-health-impacts-of-hospital-mergers/
Hidden Costs of Business: Severe Economic and Health Impacts of Hospital Mergers Revealed In New...
Jul 2, 2024 - (MADISON, WI) Stuart Craig, assistant professor of risk and insurance at the Wisconsin School of Business, has co-authored an illuminating study revealing the...
hidden costshealth impactsbusinesssevereeconomic
https://www.activemyhome.com/health-impacts-of-termites-on-humans/
Health Impacts of Termites on Humans - ACTIVE MY HOME
Mar 30, 2022 - All about the effects of anti-termite treatment on the health of occupants. Treating termites is essential for preserving the longevity and safety of a home...
health impactsmy hometermiteshumansactive
https://pure.ug.edu.gh/en/publications/a-data-intensive-framework-for-evaluating-ecological-and-human-he/
A data-intensive framework for evaluating ecological and human health impacts of soil potentially...
a dataintensive frameworkhuman healthevaluatingecological
https://decorwithstyle.com/are-cashew-peanuts-good-for-you/
Are Cashew Peanuts Good for You? Unpacking the Nutritional Benefits and Health Impacts - Decor With...
Jan 24, 2025 - In the world of healthy snacking, few options are as popular and versatile as nuts and legumes. When discussing healthy choices, cashews and peanuts often
good for younutritional benefitshealth impactscashewpeanuts
https://www.epa.gov/wildfire-smoke-course/public-health-impacts-wildfire-smoke-exposure-0
Public Health Impacts of Wildfire Smoke Exposure | US EPA
Oct 21, 2025 - Public Health Impacts of Wildfire Smoke Exposure
public health impactswildfire smokeexposureusepa
https://swachhindia.ndtv.com/covid-19-vaccine-delivery-by-age-may-mitigate-deaths-and-severe-health-impacts-study-58904/
COVID-19 Vaccine Delivery By Age May Mitigate Deaths And Severe Health Impacts: Study | News
May 7, 2021 - In order to test the efficacy of different vaccination strategies on minimizing deaths and hospitalisations, researchers built an age-structured model that...
vaccine deliveryby agehealth impactscovidmay
https://open.library.emory.edu/concern/publications/7348e51a-d04a-4b35-8182-0ed9b8a952c7
Acute health impacts of airborne particles estimated from satellite remote sensing | OpenEmory
Acute health impacts of airborne particles estimated from satellite remote sensing
satellite remote sensinghealth impactsairborne particlesacuteestimated
https://www.caribank.org/newsroom/news-and-events/youth-leaders-climate-experts-call-urgency-addressing-climate-change-related-health-impacts
Youth Leaders, Climate Experts Call for Urgency in Addressing Climate Change-Related Health Impacts...
youth leadershealth impactsclimateexpertscall
https://about.citiprogram.org/news/event-register-for-the-nih-sbe-health-impacts-of-covid-19-initiative-spring-webinar/
NIH SBE Health Impacts of COVID-19 Initiative Spring Webinar
This two-day webinar will be held on April 27-28, 2022 from 12:00 to 5:00 P.M. daily. It will provide a forum for collaboration and encourage data...
health impactsnihsbecovidinitiative
https://eprints.ncl.ac.uk/300271
Perceptions of climate change and associated health impacts among communities in Johor River Basin,...
climate changehealth impactsperceptionsassociatedamong
https://hsrc.ac.za/press-releases/eee/hsrc-to-lead-a-study-on-the-health-impacts-of-climate-adaptation-actions-in-rural-southern-africa/
HSRC to lead a study on the health impacts of climate adaptation actions in rural Southern Africa -...
Mar 24, 2019 - Human Sciences Research Council
a studyon thehealth impactsclimate adaptationsouthern africa
https://medicalupdateonline.com/2025/08/us-oil-and-gas-air-pollution-causes-unequal-health-impacts/
US oil and gas air pollution causes unequal health impacts - Medical Update Online
Aug 31, 2025 - Air pollution from oil and gas is causing 91,000 premature deaths and hundreds of thousands of health issues across the United States annually, with Black,...
oil and gasair pollutionhealth impactsmedical updateus
https://www.sciencedaily.com/releases/2016/02/160212164210.htm
Potential public health impacts of fracking in Maryland | ScienceDaily
Following their release of a state-commissioned study on the potential public health impacts of fracking in Western Maryland, researchers are helping to inform...
public health impactspotentialfrackingmarylandsciencedaily
https://foodfornet.com/types-of-legumes/
The Types Of Legumes, Their Differences, And Health Impacts | Food For Net
Apr 20, 2023 - Legumes Can Be A Healthy Plant-Based Source Of Protein. This Post Highlights The Various Types And What You Can Expect From Them.
food for netthe typeshealth impactslegumesdifferences
https://www.invasivespeciesinfo.gov/subject/human-health-impacts
Human Health Impacts | National Invasive Species Information Center
Provides selected Human Health Impacts resources from agencies and organizations with an interest in the prevention, control, or eradication of invasive...
human healthinvasive speciesinformation centerimpactsnational
https://www.acsh.org/news/2026/03/03/health-impacts-year-after-la-fires-49992
Health Impacts a Year After the LA Fires | American Council on Science and Health
One year ago, Los Angeles experienced one of the most destructive urban wildfire disasters in its history. The fires consumed more than 55,000 acres, destroyed...
health impactsla fireson scienceyearamerican
https://globalfutures.asu.edu/netz-cmi/?publication=auto-draft-98
Gopalakrishnan, V., S. Hirabayashi, G. Ziv, and B. R. Bakshi, Air Quality and Human Health Impacts...
v sb rair qualityhuman healthg
https://royalpharmacydrugs.com/patient-resources/article/1740152730596/parents-mental-health-impacts-kids-risk-of-adhd-anxiety-
Parents' Mental Health Impacts Kids' Risk of ADHD, Anxiety | Royal Pharmacy Drugs (818) 484-7484 |...
Looking for a local pharmacy with a personal touch? Royal Pharmacy Drugs offers traditional quality service with modern-day conveniences. Try us today!
mental healthparentsimpactskidsrisk
https://www.woah.org/fr/document/forecasting-the-fallout-from-amr-human-health-impacts-of-antimicrobial-resistance/
Forecasting the Fallout from AMR: Human Health Impacts of Antimicrobial Resistance (en anglais...
Oct 18, 2024 - This report presents forecasts of global and regional health burden due toAMR using historical estimates from the Global Research on Antimicrobial Resistance...
the fallouthuman healthantimicrobial resistanceen anglaisforecasting
https://documents.worldbank.org/pt/publication/documents-reports/documentdetail/675661468017054657/educational-and-health-impacts-of-two-school-feeding-schemes-evidence-from-a-randomized-trial-in-rural-burkina-faso
Educational and health impacts of two school feeding schemes : evidence from a randomized trial in...
This paper uses a prospective randomized trial to assess the impact of two school feeding schemes on health and education outcomes for children from low-income...
health impactsrandomized trialeducationaltwoschool
https://www.ruralhealthinfo.org/resources/20517
Resource Details: Health Impacts of Water and Sanitation Insecurity in the Global North: A Scoping...
Scoping review examining the literature on the physical and mental health issues associated with water and sanitation insecurity in colonias on the U.S.-Mexico...
water and sanitationresource detailshealth impactsglobal northinsecurity
https://moldtestingfortworth.com/blog/mold-detection-north-richland-hills-health-impacts-april-2026
Mold Detection North Richland Hills: 7 Health Impacts
north richland hillsmold detectionhealth impacts
https://irishheart.ie/news/inaction-on-climate-change-will-have-devastating-health-impacts/
Irish Heart Inaction on Climate Change will have devastating health impacts - Irish Heart
on climate changeirish hearthealth impactsinactiondevastating
https://psr.org/shale-gas-methane-health-impacts-2/
Shale Gas Methane Health Impacts | Physicians for Social Responsibility
shale gashealth impactsfor socialmethanephysicians
https://researchportal.murdoch.edu.au/esploro/outputs/bookChapter/The-potential-health-impacts-and-risks/991005545239907891
The potential health impacts and risks of utilising biosolids in a timber plantation - Murdoch...
During land application of biosolids in forestry, the management of the plantations following biosolids application and the harvesting of the timber, there is...
potential healthimpactsrisksbiosolidstimber
https://toxicfreefuture.org/tag/public-health-impacts/
public health impacts Archives - Toxic-Free Future
public health impactstoxic free futurearchives
https://rosap.ntl.bts.gov/view/dot/83898
Safety and Health Impacts of Mobility Alternatives Technology Transfer
Technology transfer is a vital component of the U.S. DOT University Transportation Center (UTC) program, ensuring that research findings are communicated to...
safety and healthtechnology transferimpactsmobilityalternatives
https://hitconsultant.net/2020/05/28/oncologists-social-determinants-of-health-impacts-outcomes-for-cancer-patients/
Oncologists Believe Social Determinants of Health Impacts Outcomes for Cancer Patients
May 28, 2020 - Oncologists state social determinants of health (SDOH) impact outcomes for cancer patients, according to research from Cardinal Health Specialty Solutions.
determinants of healthcancer patientsoncologistsbelievesocial