https://www.aleydasolis.com/en/
Aleyda Solis - International SEO & AI Search Optimization Consultant
ai search optimizationaleyda solisinternational seoconsultant
https://www.orainti.com/
Strategical & International SEO Consultancy | Orainti
Orainti helps brands worldwide to grow their organic search profits through Strategical and International SEO consulting. Get in touch.
international seo consultancyorainti
https://mosquita.digital/
Mosquita Digital: International SEO Consultant Barcelona
Apr 8, 2026 - Welcome to the portfolio website of an international SEO consultant Natalia Witczyk, based in Barcelona, and open to new work. Get in touch!
international seo consultantdigitalbarcelona
https://danicalorio.com/
International SEO & PPC Freelance Consultant | Daniele Calorio
Jul 24, 2025 - Do you need an experienced International SEO and Google Ads Consultant to increase your Google Search traffic abroad? Let's talk :)
international seofreelance consultantppcdaniele
https://delante.co/international-seo-services/
International SEO Services & Global Strategy | SEO / SEM Agency: Delante
We provide expert international SEO services, optimizing websites for global search or targeted countries with content, backlinks, and technical SEO.
international seo servicesglobal strategysem agencydelante
https://digitalheists.com/international-seo-agency-maryland/
International SEO Agency - Digital Heists
Apr 24, 2024 - JOIN OUR AGENCY WHERE GLOBAL VISION MEETS DIGITAL EXPERTISE International SEO Agency Maryland, USA Join Digital Heist, where we blend global vision with our...
international seo agencydigitalheists
https://delante.co/category/international-seo/
International SEO | SEO / SEM Agency: Delante SEO / SEM Blog
international seosem agencydelanteblog
https://www.getstuffdigital.co/blog/local-vs-national-vs-international-seo
Local vs National vs International SEO Explained
Learn the key differences between local, national, and international SEO to choose the right strategy based on your business goals.
international seolocalvsexplained
https://bookmark-master.com/story21391815/partner-with-the-top-international-seo-provider-in-kelowna
Partner With the Top International SEO Provider in Kelowna
partner withthe topinternational seoproviderkelowna
https://seo.co/international-seo/
International SEO: How to Rank for Foreign Location Searches
Aug 14, 2023 - International SEO is about using typical SEO principles for ranking in international locations and language-specific search terms. Read more.
how to rankinternational seoforeignlocationsearches
https://www.techleagues.com/tag/international-seo-optimization/
International SEO optimization Archives - Techleagues
international seooptimizationarchives
https://linkedbookmarker.com/story6950097/maximize-your-worldwide-visibility-using-canadian-international-seo-firms
Maximize Your Worldwide Visibility Using Canadian International SEO Firms
international seomaximizeworldwidevisibilityusing
https://geekinformatic.com/web-stories/crack-the-global-code-mastering-international-seo-with-geektech/
Crack the Global Code: Mastering International SEO with GeekTech - Geek Informatic
Aug 1, 2025 - Crack the Global Code with GeekTech! Learn key international SEO strategies to boost global visibility, reach new markets, and drive worldwide traffic.
international seocrackglobalcodemastering
https://www.first97days.com/international-seo/
International SEO Services, Best International SEO company
Apr 18, 2022 - Get ready for more customers around the globe with impressive International SEO Services. First97days is an award winning International SEO Company in USA...
international seo servicesbestcompany
https://mostfavorableoffer.com/
The Most Favorable Offer Group - International SEO Service
Nov 11, 2021 - We have been providing SEO services since 2005. You can make payment after your website appears on the first page on Google's search result.
the mostinternational seofavorableoffergroup
https://businesspan.com/some-great-benefits-of-international-seo/
Some Great Benefits of International SEO - Business Pan
Oct 26, 2021 - Whatever your business, each of you wants to make it reach maximum customers, both on the national and international scales. Just imagine your leads, traffic,...
great benefitsinternational seobusinesspan
https://guideyoursocial.com/story6399156/enhance-your-digital-reach-with-expert-international-seo-in-west-kelowna
Enhance Your Digital Reach with Expert International SEO in West Kelowna
digital reachinternational seoenhance
https://digitalmarketingservices.pro/services/international-seo/
International SEO Services ⭐ 1 Case Study ⭐ DMS
Apr 9, 2026 - Results in 30 days or money back 💰 International SEO case studies with multi-language and multi-region organic growth.
international seo servicescase studydms
https://www.fluentc.ai/tag/international-seo/
International SEO - FluentC
international seo
https://www.nativerank.com/search-engine-optimization-international-seo-savannah-ga/
International SEO in Savannah, GA - Native Rank
Dec 24, 2024 - Native Rank helps your business thrive with targeted digital marketing. Get started now!
international seosavannah ganativerank
https://www.eskimoz.co.uk/international-seo-agency/
The International SEO Agency | Eskimoz
We are an international SEO agency, with native speakers in over 12 languages, to help you get organic visibility around the world
international seo agencyeskimoz
https://www.aymen-loukil.com/en/international-seo-consultant/
International SEO consultant - Aymen Loukil
Oct 12, 2019 - Aymen Loukil : Freelance International SEO Consultant Aymen Loukil is a Freelance International SEO Consultant (Search Engine Optimization). He has been listed...
international seo consultantaymen
https://www.silkcommerce.com/digital-marketing/maximizing-international-seo-website-optimization/
Maximizing International SEO: Website Optimization - Silk Commerce
May 9, 2024 - Optimize your website for international SEO by conducting thorough keyword research, creating country-specific content, and more.
seo website optimizationmaximizinginternationalsilkcommerce
https://searchlatte.com/
Search Latte - International SEO Tool
Build Google query parameters in any combination of Google supported top level domain, country and language. Handy tool for international SEOs.
international seosearchlattetool
https://www.leadsleader.de/en/agency/seo/Bujumbura/
International SEO for Bujumbura | Maximize Traffic
Leadsleader provides global SEO services for companies in Bujumbura, Burundi. We boost your Google rankings internationally. Get a quote now!
international seobujumburamaximizetraffic
https://www.jasminedirectory.com/blog/international-seo-in-the-age-of-real-time-translation/
International SEO in the Age of Real-Time Translation
Mar 30, 2026 - You're about to discover how real-time translation is reshaping the way we think about international SEO. This isn't your typical "set it and forget it"
international seothe agereal timetranslation
https://www.twinword.com/ideas/trend/international+seo/
"international seo" Trending Keywords | Twinword Ideas
See what search keywords are trending for "international seo" and see how they are related in a word map. Discover their relationships on Google News.
international seotrending keywordstwinwordideas
https://www.pathfindermarketing.com.au/seo/seo-services-international-seo/
International SEO Company | International SEO Services - Pathfinder Marketing
international seo companyservicespathfindermarketing
https://hubwebsites.com/story21672106/top-international-seo-techniques-by-edge-tech
Top International SEO Techniques by Edge Tech
international seotoptechniquesedge
https://www.nativerank.com/search-engine-optimization-international-seo-north-carolina/
International SEO in North Carolina - Native Rank
Dec 24, 2024 - Native Rank helps your business thrive with targeted digital marketing. Get started now!
in north carolinainternational seonativerank
https://socialbaskets.com/story5863407/edge-tech-s-premier-international-seo-strategies
Edge Tech's Premier International SEO Strategies
edge techpremier internationalseostrategies
https://gleef.eu/insights/international-seo-beyond-translation-to-true-global-reach
International SEO: Beyond Translation to True Global Reach - Gleef
Ship faster with high quality translations. Improve quality, reduce errors, and save time for designers, developers, and PMs.
international seoglobal reachbeyondtranslationtrue
https://seoplaybook.ai/blog/hreflang-tags-international-seo-guide
Hreflang Tags: International SEO Without the Headaches | SEO Playbook
Apr 2, 2025 - Serving content in multiple languages or regions? Hreflang tells Google which version to show to which audience. Get it wrong and chaos ensues.
hreflang tagsinternational seowithoutheadachesplaybook
https://kbookmarking.com/story21306093/international-seo-strategies-for-companies-in-kelowna-bc
International SEO Strategies for Companies in Kelowna BC
international seofor companiesstrategieskelownabc
https://ok-social.com/story6939575/international-seo-your-comprehensive-guide
International SEO Your Comprehensive Guide
international seocomprehensiveguide
https://www.maratopia.co.uk/international-seo-london/
Intelligent International SEO Services from Maratopia
Mar 26, 2026 - International SEO Services from Maratopia ensure that your onsite and offsite SEO are at peak performance in every language and territory.
international seo servicesintelligentmaratopia
https://bookmarkfly.com/story21376068/international-seo-your-complete-guide
International SEO Your Complete Guide
international seocompleteguide
https://www.onlinetis.com/en-in/marketing/international-seo-web-positioning
onlinetis.com - Marketing - International seo web positioning
Marketing, International seo web positioning. Appears in the main search engines in all countries. Boost your Internet presence in all countries. Improve your...
international seomarketingwebpositioning
https://thebookmarknight.com/story21314779/premium-international-seo-services-for-canadian-enterprises
Premium International SEO Services for Canadian Enterprises
international seo servicespremiumcanadianenterprises
https://www.timospecht.de/en/internationale-seo/
7 tips for implementing your international SEO strategy
tips forinternational seoimplementingstrategy
https://seo-iberica.com/seo/
The International SEO service - We manage Multilingual SEO
Feb 22, 2023 - International SEO service targeting search engines over multilingual and international spread. Always with the business goal as focus.
the internationalseo servicewe managemultilingual
https://clickmedialab.com/international-seo-agency/
Top Rated International SEO Agency | Best Global SEO Services
international seo agencytop ratedbestglobalservices
https://www.seolosangeles24.com/tag/international-seo-san-clemente-california/
international SEO San Clemente California Archives - SEO Agency Los Angeles CA
international seosan clementelos angelescaliforniaarchives
https://mcm.click/how-we-help/seo/international-seo-agency/
International SEO Services - SEO Agency | MCM
Sep 5, 2024 - Do you need some support with your global business? Are you struggling to reach your target audience? We are here to help - a leading International SEO agency.
international seo servicesagencymcm
https://gcpr.net/public-relations-services/seo/
International SEO Companies - Global SEO Services | GlobalCom PR Network
Mar 9, 2026 - International SEO and PR work naturally together in the age of internet, helping PR specialists to reach the audiences in their own languages
international seoglobal servicescompaniesglobalcompr
https://www.brainz.digital/blog/category/international-seo/
International SEO - SEO Blog Category | Brainz Digital
Unlock the secrets to international SEO and growth with expert tips and strategies. Explore how to expand your business globally!
international seoblog categorybrainzdigital
https://www.coseom.com/
International SEO & Growth Marketing Barcelona | Spain | US | Germany
Feb 21, 2026 - We provide international SEO and Online Marketing for global businesses. Multilingual Growth Marketing, SEO and PPC in Spanish, German, English. Contact us!
international seogrowth marketingbarcelona spainusgermany
https://www.notprovided.eu/
Jan-Willem Bobbink – International SEO consultant
Personal blog of international SEO consultant Jan-Willem Bobbink. Sharing experiences and thoughts about search engines and online marketing!
international seojanwillemconsultant
https://www.leadsleader.de/en/agency/seo/Kyoto/
International SEO for Kyoto | Maximize Traffic
Leadsleader provides global SEO services for companies in Kyoto, Japan. We boost your Google rankings internationally. Get a quote now!
international seokyotomaximizetraffic
https://agencies.semrush.com/list/international-seo/detroit/
Best International SEO Companies in Detroit 2026 | Semrush
List of TOP 3 International SEO Companies in Detroit 2026. Discover the most skilled marketing agencies from our community to outsource your marketing to.
international seobestcompaniesdetroitsemrush
https://madesocials.com/story6914485/international-seo-your-complete-guide
International SEO Your Complete Guide
international seocompleteguide
https://ihs.ltd/how-an-international-seo-agency-in-london-can-take-your-business-global/
How a International SEO Agency in London For Global Reach
Dec 30, 2024 - L how an International SEOearn agency in London, like IHS, can help expand your business reach globally to attract international customers
seo agency in londoninternationalglobalreach
https://ninjapromo.io/services/seo/international
International SEO Services | Global SEO Company
Expanding to global markets? NinjaPromo delivers international SEO services that increase rankings, traffic, and visibility across countries.
international seo servicesglobalcompany
https://bookmarkmargin.com/story21330510/international-seo-methods-for-kamloops
International SEO Methods for Kamloops
international seomethodskamloops
https://perthdigitaledge.com.au/blog/how-to-do-international-seo/
How To Do International SEO: Step By Step Guide | Perth Digital Edge
Apr 9, 2026 - A practical step by step guide to doing international SEO, covering hreflang, content, site structure, and market research.
how to dointernational seo
https://www.rbbideas.com/category/international-seo/
INTERNATIONAL SEO Archives - RBBi
international seoarchives
https://lifeguarddigital.com/international-seo-dubai/
International SEO Dubai - Lifeguard Digital dubai
Apr 9, 2026 - Boost your global visibility with International SEO in Dubai. Lifeguard Digital delivers country-targeted SEO strategies.+971 50 846 1198
international seodubailifeguarddigital
https://gracker.ai/seo-101/hreflang-tags-international-seo
Hreflang Tags: The Definitive Guide to International SEO | SEO 101
Master hreflang tags for international SEO. This guide covers implementation, common errors, best practices, and how to target the right audience globally.
the definitive guidehreflang tagsinternational seo
https://www.designitic.com/international-seo-services/
International SEO Services By Global SEO Experts
Get your website ranked in all regions and grab more traffic with our international SEO services by global SEO experts fast and hassle free.
international seo servicesglobalexperts
https://www.searchnurture.com/blog/international-seo-benefits-and-best-practices/
International SEO: Benefits and Best Practices 2026 | Search Nurture
May 9, 2024 - What Exactly is International SEO? International SEO is a specialized form of search engine optimization (SEO) that helps companies target and rank in multiple...
international seobest practicesbenefitssearchnurture
https://www.seoitis.com/hreflang
Free Hreflang Tag Generator - International SEO Tags | SEO It Is
May 6, 2026 - Generate hreflang tags for international and multilingual SEO. Specify language and region targeting to serve the right content to the right audience worldwide.
hreflang tag generatorinternational seofreetags
https://social4geek.com/story7014211/professional-international-seo-agency-serving-western-canada
Professional International SEO Agency Serving Western Canada
international seo agencyprofessionalservingwesterncanada
https://makemelocal.com/digital-marketing/seo/international-seo
International SEO Services for Global Growth | Make Me Local
Expand into new markets with International SEO strategies built for localisation, visibility, and global growth. Make Me Local helps you scale worldwide.
international seo servicesglobal growthmake melocal
https://www.rankingroad.com/
International SEO, Google Adwords and Amazon marketing Ranking Road
May 25, 2023 - Ranking Road is the ideal partner to help with the international growth of your business, guaranteeing competitive access to foreign markets. SEO, PPC and...
international seogoogle adwordsamazon marketingrankingroad
https://top10bookmark.com/story21225168/international-seo-your-full-resource
International SEO Your Full Resource
international seofullresource
https://www.nativerank.com/search-engine-optimization-international-seo-bridgeport-ct/
International SEO in Bridgeport, CT - Native Rank
Dec 24, 2024 - Native Rank helps your business thrive with targeted digital marketing. Get started now!
international seobridgeport ctnativerank
https://martinkura.com/
Martin Kura | Grow with International SEO 💚
international seomartinkuragrow
https://www.charlesworth-group.com/search-engine-optimization-seo
International SEO Agency | Charlesworth
Get top-notch SEO services from Charlesworth. With our experience of local SEO practices, keyword usage, and language nuances, we help your business stay ahead...
international seo agency
https://bookmarkquotes.com/story21460198/expand-your-website-visibility-with-expert-international-seo-in-west-kelowna
Expand Your Website Visibility with Expert International SEO in West Kelowna
your websiteinternational seoexpandvisibility
https://articles.entireweb.com/searchengines/igal-stolpner-on-international-seo-with-ai-translated-content-competitive-analysis/
Igal Stolpner On International SEO With AI Translated Content & Competitive Analysis - Entireweb...
Apr 24, 2023 - In part one, we learned about who is Igal Stolpner, and in part two we dive into the topic of international SEO. Now we dive deeper into this topic and dig...
seo with ai
https://www.seobangkok.com/services/international-seo.html
International SEO Consultant | International SEO Services Thailand | SEO Bangkok
International SEO consultant based in Bangkok for businesses targeting multiple countries. Hreflang implementation, URL structure, ASEAN market expansion, and...
international seo consultantservicesthailandbangkok
https://perfectdigitals.co.uk/tag/complete-guide-to-international-seo/
Complete Guide to International SEO Archives - Perfect Digitals
complete guideinternational seoarchivesperfectdigitals
https://www.digitalwebengine.in/goa/international-seo-services.html
International SEO Services in Goa | Digital WebEngine
Digital WebEngine No.1 Company offers International SEO Services in Goa, Hire Best International SEO Agency in Goa to boost visibility, attract local...
international seo servicesgoadigitalwebengine
https://www.boostability.com/content/the-business-of-international-seo-ranking-and-how-to-do-it/
International SEO Ranking Tips to Boost Visibility
Jan 1, 2026 - Learn how international SEO ranking can expand your reach and ensure your brand competes on a global stage effectively.
international seorankingtipsboostvisibility
https://www.iloveseo.net/
Strategic SEO & International SEO Consultant · Gianluca Fiorelli
Dec 22, 2025 - Discover how Gianluca Fiorelli, acclaimed International SEO consultant and Strategic SEO specialist, can help your site stand out in Search and LLMS, and...
strategic seointernationalconsultantgianlucafiorelli
https://seo-iberica.com/
SEO Ibérica | Expert SEO, PPC & Web Design for Local & International Growth
Sep 15, 2025 - SEO Ibérica helps businesses increase visibility, attract qualified leads, and expand into new markets. With 14+ years of expertise in SEO, PPC, and web...
web designseoexpertppclocal
https://www.boyddigital.co.uk/
SEO Company Glasgow | International SEO | Boyd Digital
seo companyglasgowinternationalboyddigital
https://torchbox.com/seo-super-trumps/international-aid-development-seo/
SEO Audit of International Aid Nonprofit Sector | Torchbox SEO Super Trumps
A deep dive look at the organic health of UK international aid and development charities.
seo auditinternational aidnonprofit sectortorchboxsuper