https://www.it-business.de/
IT-BUSINESS – das Online-Magazin für den IT-Markt
IT-BUSINESS liefert News und Hintergründe aus dem IT-Markt für Distributoren, Dienstleister, IT-Hersteller, Service Provider und Systemhäuser.
it businessonline magazindasdenmarkt
https://www.spirityenterprise.com/
Spirity Enterprise | Cyber Security | IT Business Transformation
Spirity Enterprise offers unique end-to-end IT and cyber security services from assessments, consultancy and security operations with Bluevoyant and Cynomi.
enterprise cyber securitybusinesstransformation
https://partek.ca/
Partek I.T. Solutions — Managed IT, Business Technology, and Cybersecurity Solutions
Jul 6, 2026 - Empower your business with comprehensive Managed IT, Business Technology, and Cybersecurity Solutions from Partek IT Solutions.
i tmanaged itbusiness technologyparteksolutions
https://eibsglobal.com/
EiBS Global | Innovative IT & Business Solutions Provider
Apr 16, 2026 - EiBS Global delivers IT, ERP, CRM, AI, and digital solutions that empower businesses to streamline operations, boost efficiency, and achieve growth.
it business solutionsglobalinnovativeprovider
https://impresspro.pl/
impresspro | web development & it business partner
Jan 22, 2026 - Wspieramy firmy w cyfrowym świecie, dbając o UX/UI oraz konwersję (CRO). Strony, sklepy i aplikacje internetowe skupione na rozwiązywaniu problemów.
web developmentit businesspartner
https://www.mitp.de/
mitp-Verlag | Startseite | Der Fachverlag für IT, Business und Kreatives
Der mitp-Verlag ist einer der führenden IT-Fachbuchverlage aus Deutschland. Wir bieten unseren Lesern Profiwissen zu aktuellen Themen vom umfassenden Lehrbuch...
it businessmitpverlagstartseiteder
https://dpunkt.de/
dpunkt – der Fachverlag für IT, Business und Fotografie
Jul 6, 2026 - dpunkt – der Fachverlag für IT, Business, Fotografie, Makerthemen und Zeichnen. Fachbücher und E-Books kaufen · Keine Versandkosten in D.
it businessdpunktderfachverlagund
https://it.chosun.com/
IT조선 - Korea No.1 IT Business Leader
국내 최고의 디지털뉴스 플랫폼 IT조선은 온라인과 오프라인을 잇는 비즈니스 통찰력을 제공합니다.
it businesskorealeader
https://supernovainteractive.pl/
Zarządzanie projektami IT - Business development – Management, Consulting, Development | Supernova...
Kompleksowe wdrożenia i wytwarzanie projektów w branży IT, wprowadzanie nowych produktów na rynek. Zarządzanie i rozwój istniejących e-biznesów. Optymalizacja...
it businessmanagement consultingdevelopmentsupernova
https://bralynnnewby.com/buildit/
Build It Business Services | Bralynn Newby
it business servicesbuildnewby
https://ttlc.intuit.com/community/business-taxes/discussion/is-it-business-income-or-capital-gain/00/1382173
Solved: Is it business income or capital gain?
Mar 30, 2020 - Solved: I am an independent contractor who subs for utility companies and other contractors who perform work for them. These companies provide consumable
it businesssolvedincomecapitalgain
https://www.xing.com/profile/Maja_Parulis
Maja Parulis - IT Business Partner - Seargin DACH | XING
Maja Parulis, Berlin Professional experience, contact details, portfolio, etc.: Find out more or get in touch with Maja Parulis on XING.
it businessmajapartnerdachxing
https://itbog.org/
IT Business Owners Group
Building IT Connections Since 2015
it businessownersgroup
https://www.comarch.be/
Comarch - Global IT Business Products Provider
Comarch is a global software house delivering and integrating proprietary IT product.
global itbusiness productscomarchprovider
https://www.oit.gatech.edu/itbm
IT Business Management | Office of Information Technology
it business managementoffice ofinformationtechnology
https://www.dctexas.net/
DCTexas | Internet, Phone, Managed IT, Business Phone Systems
DCTexas provides locally supported high speed internet service, business class phone service, and managed IT services.
internet phonemanaged itbusinesssystems
https://www.essentialit.co.nz/
Essential IT - Business Support
Managed IT Services and Support in Christchurch and Canterbury New Zealand for small and medium sized businesses
essential itbusinesssupport
https://softlogicsllc.com/
Softlogics LLC | Web, App development & IT Business Solution
web app developmentit businessllcsolution
https://blink.ucsd.edu/technology/about/structure-governance/groups/business-office.html
IT Business Office
The IT Business Office provides HR and administration support including personnel actions, recruitment, employee benefits, employee relations, office space,...
it businessoffice
https://salaries.texastribune.org/departments/office-of-injured-employee-counsel/positions/it-business-analyst-ii/
It Business Analyst II | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 1 person held the It Business Analyst II position. The median salary of this position is $78,000.
it business analysttexas tribuneiigovernmentsalaries
https://blueboxjo.net/
Blue Box – IT Business Solution
blue boxit businesssolution
https://www.lrsitsolutions.com/
IT Business Infrastructure Solutions | LRS IT Solutions
LRS IT Solutions quickly and cost-effectively meets current and future Infrastructure Solutions data needs, without downtime or productivity disruption.
it businessinfrastructure solutionslrs
https://www.talentcraftit.com/
TalentCraft IT | IT Business Consulting, AI & GCP Solutions
it business consultingtalentcraftaigcpsolutions
https://ablit.com.au/
ABL IT - Business IT Specialists // North Brisbane IT Support & Service
it businessnorth brisbaneablspecialistssupport
https://www.itbctraining.com/
Login - IT Business Campus
it businesscampus
https://mizlogix.com/
Miz Logix | IT Business Solutions
Let's simplify for better
it businessmizlogixsolutions
https://worldtechenterprises.com/
IT business solutions company | World Tech Enterprises
Mar 9, 2026 - Our goal is not just technological implementation, but to generate a tangible impact for companies worldwide
it business solutionsworld techcompanyenterprises
https://business.yesmilano.it/en
YesMilano.it Business: invest, grow, and host with YesMilano | YesMilano.it Business
Discover why Milan is the ideal hub for investment, startups, and international business events. Get support from YesMilano to grow your company or plan your...
it businessinvestgrowhost
https://flexcominstitute.org/
Flexcom Institute | Best IT & Business Courses for Global Careers
Aug 26, 2025 - We offer professional IT, networking, cloud, and business training with certifications to prepare you for national and global career success.
it businessinstitutebestcoursesglobal
https://en.anjagrigoleit.de/
IT & Business Consulting & Website Design | Anja Grigoleit Beratung
With me, the technology and business strategy in your business becomes child's play. Website, online shop, email marketing, social media. Bring your service or...
it business consultingwebsite designanjaberatung
https://breakwaterit.co.uk/
Breakwater IT | Business IT Support & Services | Norwich, Norfolk
Jul 6, 2026 - Managed IT support and services that keep your business running securely. Based in Norwich, Norfolk. Let's chat: 01603 709300.
business support servicesbreakwaternorwichnorfolk
https://trilogiam.ca/
Cybersecurity IT Business Consulting
Cybersecurity should be a concern for all small business owners. Learn how Trilogiam can assess your current situation and help defend you against cyberattacks.
it businesscybersecurityconsulting
https://professional.ie/
IT & Business Training Courses - Dublin Cork Limerick Ireland
business training coursesdublincorklimerickireland
https://vickohm.com/
Vickohm IT Business Solutions
Vickohm provides businesses with expert IT services and helps them to intelligently integrate technology into their operations
it businesssolutions
https://en.shopti.mx/
IT Business - Shopti
Mar 4, 2025 - THE REVOLUTION IN B2B TECH SUPPLY At Shopti.mx, we offer a wide range of IT and technology products and services to our customers...
it business
https://thinkabout-it.co.uk/
think about IT | Business IT Services based in Cheshire
Business IT support in Cheshire providing managed IT, Microsoft 365, Cloud Backup, Cyber Security, Network Installations, and Business Telephony
think about itbusiness servicesbasedcheshire
https://www.capgemini.com/services/enterprise-management/enterprise-transformation/business-technology/
IT Business Technology services & solutions - Capgemini Invent
Mar 11, 2026 - We help to accelerate this transition to agile operating models, enabling cloud transformation, technology innovation, and a digital workplace built on trust...
business technology servicessolutionscapgeminiinvent
https://www.comp.nus.edu.sg/news-media/2018-ges/
IT, business graduates get higher starting pay - NUS Computing
it businessgraduatesgethigherstarting
https://aadplus.com/index
IT, Business Automation, ERP & Accounting | AADPlus
it businesserp accountingautomation
https://www.aoksinergi.com/
Aok Sinergi - Custom IT, Business Software & Industrial Automation
Apr 21, 2026 - Aok Sinergi, Batam software house for custom IT application, business software, industrial automation, and integrated systems
it businesssoftware industrialaoksinergicustom
https://kutyba.it/
Matt (Mateusz) Kutyba | IT Business Partner and Project Manager.
IT Business Partner and Project Manager.
it businessmattmateuszpartnerproject
https://tam-it.com/
Technology & Management IT | Business Services in Houston
it business servicestechnology managementhouston
https://hotbedtech.com/
Hosted VOIP, IT, Business Phone Systems | HotBed Technologies
business phone systemshosted voiphotbedtechnologies
https://integranetworks.com/
Integra Networks - IT Business Solutions
Sep 20, 2025 - The go-to leader in the implementation of technology solutions for the Canadian federal, provincial and local governments, as well as educational institutions,...
it businessintegranetworkssolutions
https://www.aspire.org.pl/
ASPIRE – Association of IT & Business Process Services Companies
business process servicesaspireassociationcompanies
https://salaries.texastribune.org/departments/office-of-the-attorney-general/positions/it-business-analyst-iii/
It Business Analyst III | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 6 people held the It Business Analyst III position. The median salary of this position is $90,798.
it business analysttexas tribuneiiigovernmentsalaries
https://www.itbusinesspodcast.com/
IT Business Podcast
Jul 21, 2026 - The IT Business Podcast is a show for MSPs (Managed Service Providers) and IT Professionals providing business network support and managed services. Each...
it businesspodcast
https://www.acesdirect.nl/
Aces Direct — Jouw IT Business Partner | Aces Direct
Aces Direct biedt IT-oplossingen voor bedrijven, van hardware tot complete IT-services. Ontdek ons assortiment en deskundig advies in de gehele IT Lifecycle.
aces directit businessjouwpartner
https://careers.dhl.com/eu/bg/job/DPDHGLOBALAV344703BGEUEXTERNAL/LLP-Senior-IT-Business-Partner
LLP - Senior IT Business Partner job | jobs at DHL
Apply for LLP - Senior IT Business Partner job with DHL in Valencia, Valenciana, Comunidad / Valenciana, Comunitat, Spain. jobs at DHL
it businessllpseniorpartnerjob
https://www3.monash.edu/pubs/2018handbooks/archive/aos/it-for-business.html
Areas of study archive for IT for business - 2018 Handbook - Monash University
Areas of study archive for IT for business - Monash University
areas of studyfor itarchive
https://julianeasterly.com/
Julian EASTERLY - IT Business Analyst and Software Developer
Julian EASTERLY is an American IT Business Analyst and Software Developer based in Strasbourg, France.
it business analystjulianeasterlysoftwaredeveloper
https://welldoit.solutions/
We'll Do It Business Solutions
| We'll Do It | We'll Do It
do itbusinesssolutions
https://ethikai.co.uk/
Stop Firefighting. Start Leading Your IT Business | Ethikai
Helping IT business owners escape the chaos. Build clarity, systems, and teams that work without burnout. Stop being the bottleneck. Start leading the business...
start leadingyour itstopfirefightingbusiness
https://salaries.texastribune.org/departments/texas-veterans-commission/positions/it-business-analyst-ii/
It Business Analyst II | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 1 person held the It Business Analyst II position. The median salary of this position is $79,128.
it business analysttexas tribuneiigovernmentsalaries
https://textaffin.de/
Konzeption, Text, Lektorat | IT & Business | Maria Dopslaf
May 1, 2026 - Komplexe Themen verständlich und zielgruppengerecht präsentiert. Schwerpunkte: Digitale Transformation, Green Tech, KI, Social Entrepreneurship, Smart City
it businesskonzeptiontextlektoratmaria
https://www.datacentral.com.au/
Data Central – IT business solutions
data centralit businesssolutions
https://b-it.it/
B-IT, Business e Information Technology
ICT adeguata per Innovazione di Business e Processi
it businessinformationtechnology
https://eniit.es/
Home - Eniit - IT Business School
Dec 11, 2025 - Formamos en las tecnologías más actuales a los profesionales del presente para que sean ellos los que dibujen el futuro
it businessschool
https://south.com.au/
Southcom Computers - IT business support
We offer IT support to businesses on the NSW South Coast. We provide network and workstation installation, virus protection, data backup and recovery,...
it businesssouthcomcomputerssupport
https://www.yasinakilli.com/
IT Business Continuity Blog
vEXPERT - VMCE - MCITP
it businesscontinuityblog
https://synaptica.info/
Synaptica Srl | IT Business Solutions
Sviluppo software personalizzato, private cloud, data center, server farm, fornitura hardware
it businesssynapticasrlsolutions
https://m.triz.expert/?id=10046&name=triz_techniques_and_technologies_in_the_field_of_it
TRIZ techniques and technologies in the field of IT - Business website.
Ideality program is the program which can be maintained and even improved by a programmer with a lower qualification than the author, and even without the...
in the fieldit businesstriztechniquestechnologies
https://sabreit.co.nz/
Sabre IT | Business IT Support & IT Services | Christchurch NZ
Sabre IT Christchurch, NZ manages your business IT infrastructure for zero downtime, ensuring it is secure, stable, efficient and scalable for future growth
business support servicessabrechristchurchnz
https://www.xing.com/profile/Krishna_Raval070650
Krishna Raval - IT Business development manager - Samarpan Infotech | XING
Krishna Raval, Bilimora Professional experience, contact details, portfolio, etc.: Find out more or get in touch with Krishna Raval on XING.
business development managerkrishnaravalsamarpaninfotech
https://patancollege.edu.np/
PCPS College | Best IT & Business College in Nepal
it businesspcpscollegebestnepal
https://lowker-gratis.blogspot.com/2021/03/lowongan-it-business-analyst-assurance.html
Lowongan Kerja Gratis: Lowongan IT Business Analyst Assurance
Hi all, WE ARE HIRING! Industry: IT Location: Tebet, Jakarta Position: IT Business Analyst Assurance Requirements: - Good communicatio...
it business analystlowongan kerjagratisassurance
https://itbmo.com/
ITBMO | IT Business & Financial Management Solutions | IT Cost Management
Jan 18, 2025 - ITBMO is the maker of EZTBM, The best IT business and financial management solution that lets you turn your IT cost center into a value center to thrive. Get...
business financial managementsolutionscost
https://itbusinesspartner.be/
IT Business Partner | Hewlett Packard Enterprise
it businesshewlett packardpartnerenterprise
https://www.rug.nl/society-business/center-for-information-technology/services/av-services/
AV Services | IT & Business Operations | University of Groningen
AV Services facilitates sound and imaging for the entire Univeristy of Groningen. The department is made up of specialists that assist and create with you....
av servicesit businessuniversity ofoperationsgroningen
https://www.totalityit.com/
Home | Totality IT | Business IT Services
it businesstotalityservices
https://ccg-lb.com/
CCG | Leading IT & Business Solutions Provider in Lebanon & Middle East
Consolidated Consultancy Group (CCG) offers enterprise-grade IT solutions, cloud services, network infrastructure, cybersecurity, ERP implementations (Odoo,...
it business solutionsccgleadingproviderlebanon
https://technologygofer.com/
Home - Tech Gofer | IT business consulting and Technology services
Sep 20, 2021 - Tech-Gofer is a global technology distribution and tech consulting firm with a portfolio of over 700 vendors, a team of subject matter experts and many other...
it business consultinghome techgofertechnologyservices
https://www.asolglobal.com/
ASOL - Digital Agency, IT, Business Application ,Wordpress CMS, SEO
digital agencybusiness applicationwordpress cmsasolseo
https://ecomia.com/
eComia - IT, Business Process Management, and Knowledge Process Outsourcing Company
eComia LLC is a premier IT-BPM and KPO company headquartered in Nixa, Missouri, USA, with operational hubs in Cebu City, Philippines. We specialize in...
business process managementknowledgeoutsourcingcompany
https://fortpointit.com/
Fort Point IT | Business IT Services Serving San Francisco
Fort Point managed IT service provides personalized and comprehensive solutions for businesses based in the San Francisco Bay Area.
it business servicesfort pointservingsanfrancisco
https://apply.workable.com/antenna/j/9AD0230714/
IT Business Analyst (Village Roadshow Operation Greece) - Antenna Group
Antenna Group is a leading international content, media and entertainment organization, owning and operating a diverse portfolio of global media assets across...
it business analystvillageroadshowoperationgreece
https://teckscaler.com/
We Build Scalable IT Business Solutions | TeckScaler
Dec 18, 2025 - We build scalable IT business solutions, building secure, high-performance web and mobile apps to drive your business growth.
it business solutionswe buildscalable
https://sod-it.co.uk/
SOD-IT - Business IT Support | Glasgow | Ayrshire
it businesssodsupportglasgowayrshire
https://www.planetcomputer.net/
Planet Computer - Computer IT Business Solutions
Oct 4, 2025 - Planet Computer for all your Business Computer Repair, Networking, Server Management, Helpdesk Services, Disaster Recovery needs in Central Florida.
computer itplanetbusinesssolutions
https://www.duva.it/
Massimiliano D'Uva - IT Business Consultant
Massimiliano D'Uva - AB Tech Informatica
it businessmassimilianouvaconsultant
https://jobs.ashbyhq.com/givebutter/55e0d687-aa9b-4f15-aeee-75a16565f781
Senior IT & Business Continuity Manager @ Givebutter
COMPANY DESCRIPTION Givebutter is the most-loved nonprofit fundraising and CRM platform, empowering millions of changemakers to raise more, pay less, and give...
business continuity managerseniorgivebutter
https://www.accenture.com/sk-en/careers/jobdetails?id=R00326288_sk
Junior IT Business Analyst with German
Learn more about applying for Junior IT Business Analyst with German position at Accenture.
it business analystjuniorgerman
https://expertit.co.nz/
Expert IT: Business IT Solutions & Support Auckland
IT support for Auckland SMBs. Specialising in Education, Non-profits, Accounting and Law Firms. High-accountability managed IT support, onsite and remote.
it business solutionsexpertsupportauckland
https://www.rushingships.com/
ITRS, Rushing Ships LLP, IT Business Services, | Business & IT Consulting
ITRS delivers strategic IT consulting, custom software development, digital transformation, and acting CIO services to help businesses operate smarter and...
it business servicesitrsrushingshipsllp
https://newsroom.unl.edu/announce/cse/14215/81171
Apply for IT Business System Analyst position | Announce | University of Nebraska-Lincoln
apply for ituniversity of nebraskabusiness system
https://simplicityis.co.za/
Home | VOIP | Outsourced IT | Business Internet - Simplicity Internet
Jan 5, 2021 - The best VOIP/Business internet services in South Africa, find out Why 100's of other companies made the leap. Contact us today
home voipoutsourced itbusiness internetsimplicity
https://jobs.experian.com/job/it-business-analyst-in-heredia-costa-rica-jid-524
IT Business Analyst job in Heredia, Costa Rica | Experian
This role is important for driving strategic planning, maintaining documentation standards, and implementing process improvements. You will also facilitate...
it business analystcosta ricajobherediaexperian
https://www.cihe.edu.au/
CIHE Australia | IT, Business, Education, Accounting & Research Degrees in Australia
Apr 13, 2026 - CIHE Australia offers undergraduate, postgraduate and research degrees in IT, business, education and social work and accounting within a supportive,...
it businessaccounting researchciheaustraliaeducation
https://salaries.texastribune.org/departments/texas-department-of-criminal-justice/positions/it-business-analyst-iii/
It Business Analyst III | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 5 people held the It Business Analyst III position. The median salary of this position is $71,312.
it business analysttexas tribuneiiigovernmentsalaries
https://techub.swiss/
Swiss IT Business Network | TecHUB
Techub Swiss is an association whose members are domain experts in information technology intent on expanding their organisation's influence and provide...
it businessswissnetworktechub
https://salaries.texastribune.org/departments/texas-facilities-commission/positions/it-business-analyst-i/
It Business Analyst I | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 1 person held the It Business Analyst I position. The median salary of this position is $67,527.
it business analysttexas tribunegovernmentsalariesexplorer
https://it-biz.jp/
一般社団法人 ＩＴビジネス研究会 | IT business Forum
it businessforum
https://www.oit.gatech.edu/itbmqrg
IT Business Management Quick Reference Guides | Office of Information Technology
it business managementquick reference guidesoffice ofinformationtechnology
https://jobs.sap.com/job/Dublin-24-IT-Business-Services-Senior-Consultant-Technical-Landscape-Owner-D24WA02/1376055733/
IT Business Services Senior Consultant / Technical Landscape Owner Job Details | SAP
Dublin 24 IT Business Services Senior Consultant / Technical Landscape Owner, D24WA02
it business servicessenior consultantjob details
https://www.avisiontrainings.com/index.php
Best IT & Business Training Institute in Lahore | Avision Trainings
it businesstraining institutebestlahoreavision
https://dataproactif.com/
DATAPROACTIF | IT BUSINESS PARTNER | CREATEUR DE VALEUR - DATAPROACTIF
it businesspartnercreateurdevaleur
https://www.careers.philips.com/student/global/en/job/582327/IT-Business-Analyst-Intern
IT Business Analyst Intern job in Shanghai, Shanghai, China | Internship & Apprenticeship jobs at...
it business analystintern job
https://gingerit.at/
ginger it! - Business Development & Legal Marketing
it businessgingerdevelopmentlegalmarketing
https://salaries.texastribune.org/departments/health-and-human-services-commission/positions/it-business-analyst-ii/
It Business Analyst II | Texas Tribune Government Salaries Explorer
As of April 1, 2026, 30 people held the It Business Analyst II position. The median salary of this position is $67,355.
it business analysttexas tribuneiigovernmentsalaries
https://invest-tools.com/
IT Business News - Brought to you by Invest Tools
Nov 6, 2021 - The latest business news, finance stories and technology headlines.
brought to you byit businessnewsinvesttools