https://www.kcrw.com/shows/the-treatment/stories/john-waters-1-1
John Waters | The Treatment | KCRW
Aug 18, 2000 - Elvis continues his conversation with director and screenwriter John Waters.
john watersthe treatmentkcrw
https://bitmob.com/djrezzie.html
Michael John Waters Profile
john watersmichaelprofile
https://www.wfdd.org/arts/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | 88.5 WFDD
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://photoquotes.com/author/john-waters
Quotes by John Waters | PhotoQuotes.com
John Waters Quotes - [b. 1946] American filmmaker, actor, writer, and artist. Read more photography quote by John Waters!
by johnquoteswaters
https://publicdomainmovies.info/tag/john-waters/
John Waters Movies - Public Domain Movies
john waterspublic domainmovies
https://baltimorepostexaminer.com/john-waters-sends-nasty-fun-christmas-ornaments-to-low-budget-hell-author/2012/12/06
John Waters sends nasty fun Christmas ornament to 'Low Budget Hell' author - Baltimore Post-Examiner
Dec 7, 2012 - This just in: Baltimore cult director John Waters has been checking to see who has been naughty and who has
john waterschristmas ornamentlow budgetsendsnasty
https://concertfix.com/tours/going-to-extremes-a-john-waters-80th-birthday-celebration
Going to Extremes: A John Waters 80th Birthday Celebration Tour Dates & Concert Tickets
Going to Extremes: A John Waters 80th Birthday Celebration tour dates and concert tickets. Going to Extremes: A John Waters 80th Birthday Celebration concert...
going tojohn watersbirthday celebrationtour datesconcert tickets
https://www.13af.org/waters-john-w1107-13af.cfm
John Waters - WWII Serviceman - 13AF - 0
John H Waters Served With The 13AF in World War II
john waterswwiiserviceman
https://www.wyso.org/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | WYSO
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.washingtonblade.com/tag/a-john-waters-christmas/
A John Waters Christmas Archives - Washington Blade: LGBTQ News, Politics, LGBTQ Rights, Gay News
America's Leading LGBT News Source
john waterswashington bladelgbtq newschristmasarchives
https://horror-fix.com/tag/john-waters/
John Waters - HorrorFix
john waters
https://nerdist.com/tags/john-waters/
John Waters Archives - Nerdist
john watersarchivesnerdist
https://3quarksdaily.com/3quarksdaily/2017/02/john-waters-make-trouble.html
John Waters: Make Trouble - 3 Quarks Daily
john watersmaketroublequarksdaily
https://www.jewishtimes.com/tag/john-waters/
John Waters Archives - Baltimore Jewish Times
baltimore jewish timesjohn watersarchives
https://www.lokmattimes.com/entertainment/every-singer-is-an-actress-chappell-roan-admits-encouragement-from-director-john-waters-for-acting-debut/
'Every singer is an actress': Chappell Roan admits encouragement from director John Waters for...
May 6, 2025 - 'Every singer is an actress': Chappell Roan admits encouragement from director John Waters for acting debut - Washington DC [US], May 5 : After the acting...
chappell roanjohn waterseverysingeractress
https://www.wshu.org/2025-05-30/john-waters-on-humor-as-terrorism-and-the-continuing-appeal-of-pink-flamingos
John Waters on 'humor as terrorism' and the continuing appeal of 'Pink Flamingos'
May 30, 2025 - New editions of "Pink Flamingos," "Desperate Living," and "Flamingos Forever" were released this week.
john waterspink flamingoshumorterrorismcontinuing
https://www.kasu.org/education-and-community-culture/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | KASU
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.freegreatmovies.com/Movie-Director/John-Waters/667
John Waters Movies Streaming Free Online
Watch free streaming movies by director John Waters. Watch films by this great director for free online.
john watersmovies streamingfree online
https://www.el-balad.com/16914936
John Waters on AI: 3 reasons his laughter-first worldview still lands - El-Balad.com
What happens when john waters reaches the point in life where applause arrives before he says a word? In an interview tied to his new one-man show, he treated...
john waterson aireasonslaughterfirst
https://www.khsu.org/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | KHSU
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://366weirdmovies.com/tag/john-waters/
John Waters | 366 Weird Movies
john watersweirdmovies
https://www.metrotimes.com/arts/john-waters-is-celebrating-his-birthday-in-detroit-we-are-all-invited-2475270/
Updated: Due to demand, second Detroit John Waters birthday show added
Dec 8, 2024 - It's the birthday of the "Pope of Trash" himself, John Waters, and he's celebrating in Detroit.
john watersbirthday showupdatedduedemand
https://www.mynewplaidpants.com/2019/12/john-waters-recs-us.html
my new plaid pants: John Waters Recs Us
Movies, nonsense, horror, nonsense, fellas, nonsense.
plaid pantsjohn watersnewrecsus
https://gametime.co/comedy/in-conversation-with-john-waters-tickets/7-23-2026-provincetown-ma-provincetown-town-hall/events/698a40834ebf16cfb41f6cf2
In Conversation with John Waters Provincetown TICKETS | Jul 23, 2026 at 7:00 PM @ Provincetown Town...
Get cheap In Conversation with John Waters tickets at Provincetown Town Hall on Thursday, July 23, 2026. Lowest Price Guaranteed!
in conversation withjohn watersprovincetownticketsjul
https://www.simpleseats.com/a-john-waters-christmas-tickets/
A John Waters Christmas 2026 Tickets | SimpleSeats
Be sure to grab your A John Waters Christmas tickets from SimpleSeats whenever they come to Houston. Our zone seating will help you get the best prices on A...
john waterschristmastickets
https://www.kinobaum.de/tag/john-waters/
John Waters | Der Kinobaum
Der Kinobaum - Der Blog von Roger Weil
john watersder
https://newfest.org/sections/john-waters-threesome/
John Waters Threesome Archives - NewFest
john watersthreesomearchives
https://www.theskinny.co.uk/festivals/uk-festivals/film/john-waters-on-multiple-maniacs
John Waters on bad taste cinema & Multiple Maniacs - The Skinny
The legendary director discusses his career, his anti-hippy youth, and the current political climate in the USA ahead of the re-release of Multiple Maniacs.
john watersbad tastemultiple maniacsthe skinnycinema
https://www.legrandaction.com/realisateurs/john-waters/
John Waters - Le Grand Action
Biographie et film(s) de John Waters
john watersle grandaction
https://radioradiox.com/tag/john-waters-christmas/
John Waters Christmas Archives - Radioradiox.com
john waterschristmasarchives
https://www.kazu.org/2021-12-24/filmmaker-john-waters-puts-his-own-spin-on-christmas
Filmmaker John Waters puts his own spin on Christmas | 90.3 KAZU
Dec 24, 2021 - In 2004, Waters shared music from his album A John Waters Christmas, an anthology of catchy, entertaining and ridiculous holiday songs that reflect his...
john watersspin onfilmmakerputschristmas
https://www.villagevoice.com/baltimore-in-john-waters-footsteps/
Baltimore: In John Waters' Footsteps - The Village Voice
May 11, 2017 - Baltimore kitchen, Saturday morning ] Baltimore Inner Harbor, off-season Three dollars buys a lot of fried chicken gizzards at Lexington Avenue Market. Hampden...
the village voicejohn watersbaltimorefootsteps
https://artlyst.com/director-john-waters-first-ever-london-art-exhibition-announced-for-july/
Director John Waters Explores Fame and Art - Artlyst
Apr 4, 2026 - Explore the latest from Director John Waters at his first exhibition in London, showcasing his unique take on celebrity and art.
john watersdirectorfameart
https://wac-ih3-i41fcl3th-idea-house-3.vercel.app/ih3/products/john-waters-pope-of-trash
John Waters: Pope of Trash | Idea House 3
Edited with text by Jenny He and Dara Jaffe. Foreword by Jacqueline Stewart. Text by Jeanine Basinger, B. Ruby Rich, David Simon, John Waters. Interview with...
john waterspopetrashideahouse
https://www.baltimoreorless.com/category/dreamlanders/john-waters/
John Waters | Baltimore Or Less
john watersor lessbaltimore
https://concerts.boston/tickets/a-john-waters-christmas/
A John Waters Christmas Tickets | Boston Concerts 2026
Get A John Waters Christmas Tickets for Concerts in Boston, MA. Find The Best Seats. Buy Concert Tickets Today and Save! | Concerts.Boston
john waterschristmas ticketsboston concerts
https://www.combustiblecelluloid.com/digitalwatch/serialmom.shtml
Combustible Celluloid Review - Serial Mom (1994), John Waters, John Waters, Kathleen Turner, Sam...
Combustible Celluloid Review - Serial Mom (1994), written by John Waters, directed by John Waters, and with Kathleen Turner, Sam Waterson, Matthew Lillard,...
serial momjohn waterskathleen turnercombustiblecelluloid
https://cinematreasures.org/blog/2007/9/7/john-waters-to-perform-at-historic-carolina-theatre
John Waters to perform at historic Carolina Theatre - Cinema Treasures
GREENSBORO, NC -- Whether one likes or dislikes the films of trash cinema pioneer John Waters, few can argue that he is an interesting figure in th...
john waterscinema treasuresperformhistoriccarolina
https://www.trybooking.com/events/landing/1480999?embed=true&widget=true&isEventListingWidget=true&aid=9965&source=eventListingWidget
Radio Luxembourg - John Waters & Stewart D'Arrietta Tickets, Sorrento Room, Wollongong | TryBooking...
radio luxembourgjohn watersstewartticketssorrento
https://radio.kttz.org/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | KTTZ
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.lambandhayward.co.nz/obituaries/euan-john-waters/5315/
Euan John WATERS - Obituaries - Lamb & Hayward
Jun 24, 2025 - On Thursday, November 24, 2022, passed away at home, aged 77 years. Loved husband of Shirley, loved father and father-in-law of Bronwyn and Tim, Nathan and...
john watersobituarieslambhayward
https://www.tspr.org/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.hottytoddy.com/2015/03/24/john-waters-ready-for-first-ever-visit-to-university-of-mississippi/
John Waters Ready For First-Ever Visit to University of Mississippi - HottyToddy.com - Ole Miss...
Mar 24, 2015 - John Waters is a man who wholly embraces absurdities of life. He shared this love of counterculture, and the counterculture within, through nearly all artistic...
university of mississippijohn watersreadyfirstever
https://everything2.com/title/John+Waters
John Waters
This is as comprehensive a list of John Waters movies as I can find: Hag in a Black Leather Jacket, 1964 Roman Candles, 1966 Eat Your Makeup, 1968 Mondo...
john waters
https://www.eventticketscenter.com/a-john-waters-christmas-tickets/10102/c
A John Waters Christmas Tickets, Comedy Shows & 2026 Tour Dates
Find A John Waters Christmas tickets and tour dates 2026. Shop tickets for all A John Waters Christmas comedy shows on the current A John Waters Christmas...
john waterschristmas ticketscomedy showstour dates
https://www.kgou.org/arts-and-entertainment/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | KGOU - Oklahoma's NPR Source
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.rockthebodyelectric.com/2020/08/live-streams-john-waters-in.html
Rock The Body Electric: Live Streams: John Waters in conversation with Jim Jarmusch
in conversation withthe bodylive streamsjohn watersjim jarmusch
https://hyperallergic.com/tag/john-waters/
John Waters - Hyperallergic
john watershyperallergic
https://www.ilcinemaniaco.com/liarmouth-aubrey-plaza-protagonista-del-film-di-john-waters/
Liarmouth: Aubrey Plaza protagonista del film di John Waters
Liarmouth riporta John Waters alla regia del romanzo scritto da lui nel 2022. Con Aubrey plaza ecco le notizie al riguardo.
aubrey plazajohn watersprotagonistadelfilm
https://www.twifordfh.com/obituaries/John-Waters?obId=27030920
Obituary information for John Waters
View John Waters's obituary, contribute to their memorial, see their funeral service details, and more.
information forjohn watersobituary
https://www.thenextchapterli.com/product/liarmouth-a-feel-bad-romance-john-waters/3058
Liarmouth: A Feel-Bad Romance - John Waters | The Next Chapter
This book is a wild and vile ride. Absurd, abhorrent, tawdry and hilarious. It is not a novel for the faint of heart. If you have ever considered clutching a...
the next chapterbad romancejohn watersfeel
https://www.electric-shadows.com/tag/john-waters/
John Waters Archives - Electric Shadows
john watersarchiveselectricshadows
https://bmvbookshop.com/item/MWp_c1qAP1yqKV8j6sxYzQ
Pink Flamingos by John Waters | BMV Bookstore
The return of a spectacular, reviled, and iconic classic of American filth! John Waters takes us back to the scene of his original crime against good taste.
pink flamingosby johnwatersbmvbookstore
https://www.dcnyhistory.org/OwensJohnWandWfClarissa.html
John Waters Owens and wife Clarissa Tiffany - Delaware County NY Genealogy and History Site
The Delaware County NY Genealogy and History Site is an attempt to gather in one place many of the public domain records for genealogical research in Delaware...
john watersdelaware countyowenswifeclarissa
https://trailersfromhell.com/female-trouble/44c52aeb3743f71d1320bba657473091-john-waters-trouble/
44c52aeb3743f71d1320bba657473091-john-waters-trouble - Trailers From Hell
john watersfrom helltroubletrailers
https://www.bigissue.com/culture/john-waters-no-thing-counterculture/
John Waters: "There is no such thing as a counterculture" - Big Issue
Apr 20, 2017 - Outsiders, insiders and stalking. Hitch a ride with cult filmmaker John Waters... if you dare
no such thingjohn watersthere isbig issuecounterculture
https://airmail.news/arts-intel/events/coming-attractions-the-john-waters-collection
The John Waters Collection at the Baltimore Museum of Art: Arts Intel Report
In November, Waters's private collection goes public at the Baltimore Museum of Art with the exhibition "Coming Attractions: The John Waters Collection," which...
museum of artjohn watersintel reportcollectionbaltimore
https://www.interviewmagazine.com/culture/john-waters-this-filthy-world
Coming In with John Waters - Interview Magazine
Jul 19, 2013 - At City Winery, we met John Waters at a private dinner composed of a small group nestled among large steel wine casks. Wearing a dapper white suit, he was kind...
coming injohn watersinterview magazine
https://www.standbyformindcontrol.com/tag/john-waters/
John Waters | Stand By For Mind Control
john watersstand bymind control
https://www.wboi.org/2021-12-24/filmmaker-john-waters-puts-his-own-spin-on-christmas
Filmmaker John Waters puts his own spin on Christmas | WBOI - NPR News & Diverse Music in Northeast...
Dec 24, 2021 - In 2004, Waters shared music from his album A John Waters Christmas, an anthology of catchy, entertaining and ridiculous holiday songs that reflect his...
john watersspin onnpr newsfilmmakerputs
https://gript.ie/john-waters-contesting-election-grave-national-crisis/
John Waters contesting election due to 'grave national crisis' - Gript
Jan 24, 2020 - Former journalist John Waters has announced he will run as an Independent candidate in the upcoming general election, affiliating himself with the...
john waterscontestingelectionduegrave
https://w2mnet.com/the-trash-trilogy-john-waters-movie-review/
The Trash Trilogy John Waters Movie Review - W2Mnet
Jun 1, 2023 - We present our The Trash Trilogy John Waters Movie Review! The Trash Trilogy includes Pink Flamingos, Female Trouble and Desperate Living.
the trashjohn watersmovie reviewtrilogy
https://thirdcoastreview.com/tag/john-waters
John Waters Archives | Third Coast Review
john watersarchivesthirdcoastreview
https://momus.ca/tag/john-waters/
John Waters | Momus
Momus is an independent platform for art writing and criticism.
john watersmomus
https://nerdbot.com/2023/12/21/john-waters-to-play-good-guys-doll-creator-in-chucky-s3/
John Waters to Play Good Guys Doll Creator in "Chucky" S3
Dec 21, 2023 - The "Pope of Trash" and legendary filmmaker, writer, and actor John Waters is joining the cast of "Chucky" Season 3, Part 2.
john watersto playgood guysdollcreator
https://www.worthamarts.org/events/a-john-waters-christmas-its-a-yuletide-massacre/john-waters-banner/
John Waters Banner - Wortham Center for the Performing Arts
john waterswortham centerfor theperforming artsbanner
https://lifestories.org/interviewees/john-waters
John Waters - Filmmaker - Interviewees - Life Stories Interviews
Life Stories produces and distributes documentary films about people whose lives inspire meaningful change.
john waterslife storiesfilmmakerintervieweesinterviews
https://glidemagazine.com/17885/john-waters-cheech-marin-henry-rollins-donald-glover-added-to-bonnaroo/
John Waters, Cheech Marin, Henry Rollins, Donald Glover Added To Bonnaroo - Glide Magazine
Apr 11, 2011 - Bonnaroo has announced an eclectic host of national headlining comics in its ever-popular seated, air-conditioned comedy venue. This year's comics include
john waterscheech marinhenry rollinsdonald gloveradded
https://www.ecurrent.com/film/michigan-theater-presents-cry-baby-by-john-waters/
Michigan Theater presents "Cry-Baby" by John Waters - Current Magazine
Apr 12, 2021 - Celebrating the work of writer and director John Waters, the Michigan Theater presents Cry-Baby
michigan theatercry babyjohn waterscurrent magazinepresents
https://www.ukcolumn.org/writer/john-waters
John Waters | UKColumn
john watersukcolumn
https://www.salamancapress.com/2024/11/27/nordstrom-nyc-transforms-with-the-blizz-on-57th-street-holiday-takeover-starring-john-waters-and-fran-drescher/
NORDSTROM NYC TRANSFORMS WITH THE BLIZZ ON 57TH STREET HOLIDAY TAKEOVER STARRING JOHN WATERS AND...
Nov 28, 2024 - NEW YORK, Nov. 27, 2024 /PRNewswire/ -- This holiday season, Nordstrom NYC's flagship on 57th Street will be immersed in a world of wonder as part of the...
john watersnordstromnyctransformsblizz
https://www.hppr.org/2026-04-17/filmmaker-john-waters-aka-the-pope-of-trash-turns-80
Filmmaker John Waters -- aka the 'Pope of Trash' -- turns 80 | HPPR
Apr 17, 2026 - Once called the "King of Bad Taste," Waters is known for his off-beat cult films Pink Flamingos and Polyester, as well as the more mainstream Hairspray....
john watersthe popefilmmakerakatrash
https://www.miaminewtimes.com/arts-culture/why-john-waters-is-not-reading-this-blog-6489637/
Why John Waters Is Not Reading This Blog
Apr 16, 2009 - Filmmaker John Waters hasn't made a public appearance in Miami since 2002, when he screened the film Boom! at Art Basel, but the "Pope of Trash" is back,...
john watersis notthis blogreading
https://www.wvxu.org/2021-12-24/filmmaker-john-waters-puts-his-own-spin-on-christmas
Filmmaker John Waters puts his own spin on Christmas | WVXU
Dec 24, 2021 - In 2004, Waters shared music from his album A John Waters Christmas, an anthology of catchy, entertaining and ridiculous holiday songs that reflect his...
john watersspin onfilmmakerputschristmas
https://freshairarchive.org/segments/tamer-john-waters
A Tamer John Waters. | Fresh Air Archive: Interviews with Terry Gross
Film critic Stephen Schiff reviews "Hairspray," the latest film by director and writer John Waters. "Hairspray," a satire of the teen dance shows of the early...
john watersfresh airarchive interviewsterry grosstamer
https://www.kcbx.org/2021-12-24/filmmaker-john-waters-puts-his-own-spin-on-christmas
Filmmaker John Waters puts his own spin on Christmas
Dec 24, 2021 - In 2004, Waters shared music from his album A John Waters Christmas, an anthology of catchy, entertaining and ridiculous holiday songs that reflect his...
john watersspin onfilmmakerputschristmas
https://mostfamousbirthdays.com/john-waters-13799-age-height-born-details.php
John Waters birthday, age, height & details
john watersbirthday ageheightdetails
https://www.losangelesblade.com/2017/04/25/john-waters-camp-director-adult-summer-camp/
John Waters to be camp director for adult summer camp
Aug 28, 2021 - the weekend is already sold out
john watersto beadult summercampdirector
https://ncmedsoc.org/tag/john-waters/
John Waters Archives - North Carolina Medical Society
john watersnorth carolinaarchivesmedicalsociety
https://bookmans.com/tag/john-waters/
John Waters Archives - Bookmans Entertainment Exchange
john watersentertainment exchangearchives
https://www.wwno.org/npr-news/npr-news/2004-11-15/for-john-waters-the-tingler-still-resonates
For John Waters, 'The Tingler' Still Resonates | WWNO
Feb 9, 2022 - John Waters' films have been described as raunchy, perverse and hilarious. So it comes as no surprise that he would pick a scene from a 1959 William Castle...
for johnwaterstinglerstillwwno
https://www.customerlobby.com/reviews/7728/john-waters-heating-cooling-electric/appointment
Appointment with John Waters Heating, Cooling & Electric - Louisville, KY 40299-2533
john waterslouisville kyappointmentheatingcooling
https://www.openculture.com/2014/03/john-waters-talks-about-his-books-and-role-models-in-a-whimsical-animated-video.html
John Waters Talks About His Books and Role Models in a Whimsical Animated Video
Kudos to cartoonist Flash Rosenberg for having the huevos to illustrate cult film icon John Waters' remarks at the New York Public Library in real time before...
john waterstalks abouthis booksrole modelsanimated video
https://adrants.com/john-waters-movie-poster-wont-need-retouching/
John Waters Movie Poster Won't Need Retouching
Feb 19, 2025 - Poor Keira Knightley had to have her boobs expanded for the movie poster promoting her starring role in King Arthur. For Selma Blair, who appears in the...
john watersmovie posterneedretouching
https://www.kqed.org/arts/115691/greatest_hits_john_waters
Greatest Hits: John Waters & 'Role Models' | KQED
The Writers' Block is evolving into something new! But, before we get to where we're going, let's take a look back at where we've been. In light of Baltimore's...
greatest hitsjohn watersrole modelskqed
https://phindie.com/tag/john-waters/
John Waters Archives - phindie
john watersarchivesphindie