https://www.ptcnews.tv/accommodate-ukraine-returned-students-in-indian-medical-colleges-mamata-banerjee-to-pm-modi
Accommodate Ukraine-returned students in Indian medical colleges: Mamata Banerjee to PM Modi | Jobs...
Mar 16, 2022 - West Bengal Chief Minister Mamata Banerjee has written to Prime Minister Narendra Modi, seeking his immediate intervention to facilitate the further studies of...
returned studentsmedical collegesmamata banerjeepm modiaccommodate
https://www.indiatvnews.com/entertainment/news/the-kerala-story-director-sudipto-sen-urges-mamata-banerjee-to-watch-his-film-very-unfortunate-2023-05-09-869745
The Kerala Story director Sudipto Sen urges Mamata Banerjee to watch his film: 'Very...
May 9, 2023 - Sudipto Sen has requested The CM of West Bengal Mamta Banerjee to watch his film once.
sudipto senmamata banerjeekeralastorydirector
https://manufacturing.economictimes.indiatimes.com/news/industry/mamata-invites-british-businesses-to-invest-in-bengal/119515161
West Bengal Chief Minister: Mamata invites British businesses to invest in Bengal, ETManufacturing
West Bengal Chief Minister: Speaking at an interactive session on 'Opportunities in West Bengal' in London, the video of which was shared on the chief...
west bengalchief ministermamatainvitesbritish
https://www.domain-b.com/people/in-the-news/naidu-mamata-team-up-to-fight-cbi-and-bjp
Naidu, Mamata team up to fight CBI and BJP | Domain-b.com
team upb comnaidumamatafight
https://www.newindianexpress.com/nation/2025/May/06/dont-listen-to-bjp-religious-fundamentalists-and-create-division-among-yourselves-mamata-at-murshidabad
'Don't listen to BJP, religious fundamentalists and create division among yourselves': Mamata at...
Mamata Banerjee alleged that rioters are being brought to the state from outside to create unrest and urged people not to get provoked by such measures by "the
listen tobjpreligiousfundamentalistscreate
https://thenews21.com/mamata-da-arrears-bengal-election-poll-dates-ropa-2009-2026
Mamata's DA Arrears Move Before Bengal Poll Dates Sparks Row
Mar 16, 2026 - Mamata Banerjee announced ROPA 2009 DA arrears minutes before Bengal poll dates. Opposition's Suvendu Adhikari called it a last-minute gimmick with no funds...
mamatadaarrearsmovebengal
https://www.collegedekho.com/colleges/mamata-medical-college-campus
Mamata Medical College Campus Facilities - Hostel Fees, Infrastructure, Address
Check Mamata Medical College campus location, classrooms, hostels, amenities, and all the other facilities available inside and outside the campus.
medical collegecampus facilitieshostel feesmamatainfrastructure
https://nagalandpost.com/bjp-threatening-tmc-candidates-for-support-if-it-fails-to-get-majority-mamata/
BJP threatening TMC candidates for support if it fails to get majority: Mamata
Apr 12, 2026 - West Bengal Chief Minister Mamata Banerjee on Sunday alleged that the BJP was threatening TMC candidates, including state ministers, seeking their support if...
for supportto getbjpthreateningtmc
https://www.catchnews.com/west-bengal-election/gjm-triumph-darjeeling-hills-vote-for-gorkhaland-reject-mamata-s-tmc-1463665653.html
GJM triumph: Darjeeling hills vote for Gorkhaland, reject Mamata's TMC | Catch News
Mamata Banerjee's wave stopped in the plains of Bengal. GJM sweeps Darjeeling hills
triumphdarjeelinghillsvotegorkhaland
https://ishare.rediff.com/video/others/making-nephew-the-chief-minister-amit-shah-s-all-out-attack-on-cm-mamata-in-west-bengal-election/11380376?pos=viewedrtnow
Making nephew the Chief Minister Amit Shah s all out attack on CM Mamata in West Bengal Election...
Watch Making nephew the Chief Minister Amit Shah s all out attack on CM Mamata in West Bengal Election video online on Rediff Videos. More videos of Making,...
west bengal electionthe chiefamit shahall outmaking
https://menafn.com/1111016152/I-PAC-Raid-Row-SC-Says-Mamata-Banerjees-Conduct-Put-Democracy-In-Peril
I-PAC Raid Row: SC Says Mamata Banerjee's Conduct Put 'Democracy In Peril'
I-PAC Raid Row: SC Says Mamata Banerjee's Conduct Put 'Democracy In Peril'. New Delhi, April 22 (IANS) The Supreme Court on Wednesday orally remarked that the...
mamata banerjeepacraidrowsc
https://www.awazthevoice.in/opinion-news/west-bengal-polls-in-first-phase-seats-outcome-crucial-for-mamata-bjp-57706.html
West Bengal Polls: In first phase, 152 seats outcome crucial for Mamata, BJP
The first phase of the West Bengal Assembly elections is more than a mere electoral event, acting as a referendum on various aspects such as identity,...
west bengalpollsfirstphaseseats
https://reportwire.in/india/kabirs-controversial-attack-mamata-rude-woman-who-wont-quit-cm-post/
Kabir's Controversial Attack: Mamata 'Rude Woman' Who Won't Quit CM Post - Report Wire
May 6, 2026 - Victory tastes sweeter with controversy. AJUP president and dual-seat winner Humayun Kabir stirred the pot by calling Mamata Banerjee a 'badtameez aurat'
post reportkabircontroversialattackmamata
https://highlandpost.com/didi-unseated-mamata-loses-bengal-and-bhabanipur-as-bjp-rewrites-the-script/
Didi unseated: Mamata loses Bengal and Bhabanipur as BJP rewrites the script | Highland Post
May 4, 2026 - Kolkata, May 4: The script that once defined her politics--defiance, comeback, control--has been upended with ruthless symmetry. Mamata Banerjee, the
the scripthighland postdidimamataloses
https://news.webindia123.com/news/Articles/India/20260412/4438197.html
Mamata Banerjee gone crazy as TMC's infiltrator-backed poll strategy failed: BJP's Dilip Ghosh
BJP leader and candidate from Kharagpur Sadar Assembly constituency, Dilip Ghosh, on Sunday launched a sharp attack on West Bengal Chief Minister Mamata...
mamata banerjeedilip ghoshgonecrazytmc
https://www.telegraphindia.com/west-bengal/bengal-assembly-polls-2021-mamata-modi-make-firing-deaths-the-cornerstone-of-campaign/cid/1812345
West Bengal Assembly Elections 2021 | Bengal elections 2021: EC bars Mamata from campaigning till...
TMC, BJP blame each other for firing deaths amid canvassing for Phase-V polls
west bengalassemblyelectionsbarsmamata
https://www.timesnownews.com/india/west-bengal-2026-assembly-election-ghuspaithiya-crackdown-sir-anti-incumbency-bjp-tmc-mamata-banerjee-article-154125825
Bengal 2026: Has 'Ghuspaithiya' Crackdown Flipped The Script In Mamata's Favour? | Times Now
Apr 23, 2026 - From anti-incumbency to identity politics, the 2026 West Bengal electoral battle will be shaped by SIR, voter deletions, and the 'ghuspaithiya' crackdown.,...
the scripttimes nowbengalcrackdownflipped
https://kannada.barandbench.com/topic/mamata-banarjee
Mamata Banarjee
Read stories listed under on Mamata Banarjee
mamata
https://www.etcnepal.com/manaka-kura-by-mamata-dipabima/
Manaka Kura by Mamata Dipabima Ft. Kusum Gurung With Lyrics
Jun 14, 2017 - Manaka Kura is a new Nepali pop song by Mamata Dipabima. The music video features Kusum Gurung. Manaka Kura is directed by Naren Limbu. The music video was...
manakakuramamataftgurung
https://www.livemint.com/news/india/mamata-banerjees-big-claim-ahead-of-bengal-polls-up-rajasthan-people-staying-at-hotels-with-money-to-11776336355556.html
Mamata Banerjee's big claim ahead of Bengal polls: 'UP, Rajasthan people staying at hotels with...
Apr 16, 2026 - West Bengal CM Mamata Banerjee accused the government of linking women's quota and delimitation bills to manipulate electoral rolls and implement NRC. She...
mamata banerjeebigclaimaheadbengal
https://www.news9live.com/india/mamata-banerjee-is-india-bloc-head-mani-shankar-aiyas-message-to-rahul-gandhi-2934696
'Mamata Banerjee is INDIA Bloc head': Mani Shankar Aiya's message to Rahul Gandhi | India News -...
Feb 23, 2026 - Mani Shankar Aiyar made yet another controversial remark regarding his own party, the Congress. He advised Rahul Gandhi that he should let regional leaders...
mamata banerjeerahul gandhiindiablochead
https://www.deccanherald.com/elections/west-bengal/west-bengal-assembly-elections-2026-paramilitary-chiefs-meet-in-kolkata-mamata-banerjee-flags-central-agency-misuse-amid-ed-i-t-raids-3973853
West Bengal Assembly Elections 2026 | Paramilitary chiefs meet in Kolkata; Mamata Banerjee flags...
West Bengal elections: Chiefs of central paramilitary forces review security, tech use and deployment plans ahead of April 23 and 29 polling. Meeting in...
west bengalmamata banerjeeassemblyelectionsparamilitary
https://bynewsindia.com/politics/mamata-slams-bjp-over-voter-rights/
Mamata slams BJP over voter rights - ByNewsIndia
Mar 23, 2026 - West Bengal Chief Minister (CM) Mamata Banerjee on Saturday accused the BJP-led Union Government snatching away voting rights through the Special Intensive Revi
voter rightsmamataslamsbjp
https://lokmarg.com/bjps-ideology-is-self-centred-mamata/
BJP's Ideology Is Self-Centered Mamata | Lokmarg
Jan 4, 2023 - West Bengal Chief Minister Mamata Banerjee on Tuesday hit out at the Bharatiya Janata Party (BJP) and said that the BJP's ideology is to be...
bjpideologyselfcenteredmamata
https://www.lokmattimes.com/politics/mamata-banerjees-magic-is-fading-away-congress-mp-adhir-chowdhury/
'Mamata Banerjee's magic is fading away...': Congress MP Adhir Chowdhury - www.lokmattimes.com
Apr 19, 2023 - 'Mamata Banerjee's magic is fading away...': Congress MP Adhir Chowdhury - Kolkata (West Bengal) [India], April 19 : Congress MP Adhir Ranjan Chowdhury has hit...
mamata banerjeemagicfadingawaycongress
https://infantry-center.com/2021/11/27/why-amit-mitra-is-important-to-mamata/
Why Amit Mitra is important to Mamata | Political News, Analysis and Opinion
Nov 27, 2021 - No longer Bengal's finance minister, Amit Mitra, Mamata's principal chief advisor, will still advise and aid the 'chief minister and finance department on all...
analysis and opinionpolitical newsamitmitraimportant
https://www.ndtv.com/india-news/haryana-ministers-bull-comparison-to-mamata-banerjee-jai-shri-ram-row-2357167
Haryana Minister Anil Vij's Bull Comparison To Mamata Banerjee-Jai Shri Ram Row
Haryana Home Minister Anil Vij on Saturday hit out at West Bengal Chief Minister Mamata Banerjee, saying ''Jai Shri Ram'' slogan to her is like "red rag to a...
mamata banerjeeharyanaministeranilbull
https://www.business-standard.com/article/pti-stories/shah-questions-chit-fund-owners-buying-mamata-s-paintings-119012901034_1.html
Shah questions chit fund owners buying Mamata's paintings
BJP president Amit Shah launched a scathing attack against the TMC government in West Bengal on Tuesday and alleged that Chief Minister Mamata Banerjee's...
shahquestionschitfundowners
https://southasiajournal.net/post/india/61205/statement-in-protest-of-the-violent-meme-targeting-mamata-banerjee-and-the-muslim-community
Statement in Protest of the Violent Meme targeting Mamata Banerjee and the Muslim Community | South...
Following is a statement signed by 1815 people protesting against the violent anti-Muslim and misogynist meme that had been circulating, targeting West Bengal...
mamata banerjeestatementprotestviolentmeme
https://www.indianeconomicobserver.com/news/government-formation-efforts-gain-momentum-in-tamil-nadu-assam-bengal-kerala-mamata-says-will-not-resign-as-cm20260507015457/
Government formation efforts gain momentum in Tamil Nadu, Assam, Bengal, Kerala; Mamata says will...
Efforts for government formation picked up pace in Tamil Nadu, West Bengal, Kerala, Assam and Puducherry with the parties and alliances that won the polls also...
tamil nadugovernmentformationeffortsgain
https://www.aajkaal.in/west-bengal/mamata-banerjee-announcement-in-siliguri-173914
Mamata Banerjee announcement in siliguri
Mamata Banerjee announcement in siliguri
mamata banerjeeannouncementsiliguri
https://udayavani.com/mamata-banerjee-voter-list-deletion-90-lakh-bjp-west-bengal-assembly-election-2026-067474?lang=en
BJP deleted over 90 lakh names from voter lists during SIR to grab power in Bengal, alleges Mamata...
Apr 9, 2026 - The TMC supremo said the ruling party would move a court to ensure that all those deleted from the electoral rolls are reinstated.
bjpdeletedlakhnamesvoter
https://www.businesstoday.in/india/story/set-aside-your-ego-accept-mamata-as-tmcs-message-to-congress-after-maharashtra-debacle-454979-2024-11-25
'Set aside your ego, accept Mamata as...': TMC's message to Congress after Maharashtra debacle -...
Nov 25, 2024 - Kalyan Banerjee highlighted the Congress' recent electoral failures, particularly its debacle in Maharashtra, as evidence of the need for "unified and...
set asideyour egoacceptmamatatmc
https://northeastrising.in/will-win-bengal-with-one-leg-delhi-with-two-mamata-banerjee/
Will win Bengal with one leg, Delhi with two: Mamata Banerjee - North East Rising
Apr 5, 2021 - Mamata Banerjee on Monday said she is confident of her win in the 2021 state assembly polls and then later, she would aim for power in Delhi.
mamata banerjeenorth eastwinbengalone
https://www.devdiscourse.com/article/Newsalert/3869302-mamata-banerjee-wants-to-protect-infiltrators-bjp-wants-to-detect-delete-and-deport-illegal-immigrants-shah-at-poll-rally
Mamata Banerjee wants to protect infiltrators, BJP wants to 'detect, delete and deport' illegal...
Read more about Mamata Banerjee wants to protect infiltrators, BJP wants to 'detect, delete and deport' illegal immigrants: Shah at poll rally in Bengal. on...
mamata banerjeewantsprotectinfiltratorsbjp
https://livdose.com/election-result-date-mamata-banerjees-big-charge-before-counting-of-votes-in-west-bengal-power-cuts-cctv-turned-off/
Election Result Date: Mamata Banerjee's Big Charge Before Counting Of Votes In West Bengal: Power...
May 4, 2026 - Mamata Banerjee's allegations came hours before the counting of votes for West Bengal assembly elections was scheduled to begin.
election resultmamata banerjeewest bengaldatebig
https://www.etvbharat.com/en/!bharat/factually-incorrect-to-cover-up-delays-centre-slams-mamata-banerjee-in-reply-to-her-letter-enn24083100153
'Factually Incorrect...To Cover Up Delays': Centre Slams Mamata Banerjee In Reply To Her Letter
Aug 31, 2024 - In a second letter to Mamata Banerjee in a week, Union minister for women and child development Annapurna Devi pointed out that the West Bengal government had...
cover upmamata banerjeefactuallyincorrectdelays
https://www.pgurus.com/system-in-danger-supreme-court-pulls-up-mamata-before-bengal-voting/
Supreme Court rebukes Mamata Banerjee over probe interference ahead of Bengal polls
Apr 23, 2026 - A day before voting, SC pulls up Mamata Banerjee over alleged probe interference as ED steps up action against TMC leaders
supreme courtmamata banerjeeprobeinterferenceahead
https://indileak.com/raising-jai-sri-ram-slogan-is-indecent-for-mamata/
Raising "Jai Sri Ram" slogan is indecent for Mamata - Indileak.com
May 31, 2019 - Kolkata: West Bengal Chief Minister Mamata Banerjee on Thursday spewed anger and lashed out at people chanting "Jai Sree Ram" around her convoy in West
raisingjaisriramslogan
https://sportsz.news/news/odisha-strengthens-maternal-care-with-inr-500-crore-investment-under-mamata-and-pm-matru-vandana-yojana/
Odisha Strengthens Maternal Care with INR 500 Crore Investment Under Mamata and PM Matru Vandana...
Mar 23, 2026 - Stay updated with the latest sports news, live scores, match highlights, sports news today, and expert analysis from around the world.
maternal careodishainrcroreinvestment
https://www.republicworld.com/india/we-will-revoke-uniform-civil-code-bill-when-mamata-s-promise-before-bengal-polls
'We Will Revoke Uniform Civil Code Bill When...': Mamata's Promise Before Bengal Polls | Republic...
Apr 11, 2026 - "They have spoken about UCC (Uniform Civil Code) in the manifesto...I will vehemently oppose this. They are in majority today so they will pass the Bill. When...
uniform civil coderevokebillmamatapromise
https://www.prameyanews.com/mamata-banerjee-holds-padyatra-in-bhabanipur-constituency
Mamata Banerjee holds padyatra in Bhabanipur constituency - Prameya News
West Bengal Chief Minister Mamata Banerjee on Sunday held a padyatra in Bhabanipur Assembly constituency and interacted with the people.
mamata banerjeeholdsconstituencynews
https://argusnews.in/politics/west-bengal-constitutional-crisis-mamata-banerjee-resignation-deadlock
Bengal Crisis: Who Will Rule if Mamata Refuses to Resign Today? | Argus News
May 7, 2026 - With the Assembly term ending May 7, West Bengal faces a crisis as Mamata Banerjee refuses to resign. Will Governor R.N. Ravi intervene?
bengalcrisisrulemamatarefuses
https://tripuranet.com/mamata-banerjee-vows-not-to-resign.html
Mamata Banerjee vows not to resign after shocking defeat - Tripura Net
May 5, 2026 - Refusing to step down despite a major electoral setback, Mamata Banerjee on Tuesday asserted that she would not resign as Chief Minister, arguing that the
mamata banerjeevowsresignshockingdefeat
https://odishabytes.com/mamata-was-impediment-bangladesh-eyes-resolution-of-teesta-waters-treaty-after-bjp-sweeps-bengal/
'Mamata Was Impediment'; Bangladesh Eyes Resolution Of Teesta Waters Treaty After BJP Sweeps Bengal...
May 6, 2026 - Dhaka: Bangladesh believes that the issue regarding the sharing of Teesta waters will be resolved, now that the BJP has
mamataimpedimentbangladesheyesresolution
https://www.jamesuncle.com/service/House-keeping-cleaner-Mamata-Barman-in-Amrail
House keeping cleaner Mamata Barman in Amrail
Register your profession, and reach to the hundreds of people, who are in searching for skilled person like you.. With Rs. 1999 per year.
house keepingcleanermamatabarman
https://telugustop.com/someone-messaged-me-threatening-to-arrest-abhishek-banerjee-mamata-latest-eng-news-11783840
Someone messaged me threatening to arrest Abhishek Banerjee: Mamata - Abhishek, Banerjee, Congress,...
Aug 28, 2023 - Kolkata Aug 28 : West Bengal Chief Minister Mamata Banerjee On Monday Claimed That She Had Received A Message From An Unknown Person Threatening To Arrest...
abhishek banerjeesomeonethreateningarrestmamata
https://www.indiatv.in/video/kurukshetra/coffee-par-kurukshetra-modi-wins-opponents-lose-sleep-what-is-mamata-s-decision-after-the-bad-defeat-2026-05-06-1216581
Coffee Par Kurukshetra: Modi wins, opponents lose sleep, what is Mamata's decision after the bad...
May 6, 2026 - Bengal has transformed, fear has been replaced by trust, and saffron has gained popularity. The Bengal elections have strengthened the consolidation of Hindu...
coffee par kurukshetrawhat ismodiwinsopponents
https://thespace.ink/voices-views/interview-mamata-shankar-on-her-first-radio-play/
Interview: Mamata Shankar On Her First Radio-Play - The Space Ink
May 23, 2025 - Excerpts of an exclusive conversation with the veteran performer Mamata Shankar, as thespace.ink caught up with her backstage after an electrifying performance.
the spaceinterviewmamatashankarfirst
https://odiasong.net/swargare-nuhen/download/13771.html
Swargare Nuhen Mamata Sahu Mp3 Song Download - OdiaSong.Net
Swargare Nuhen Sung By Mamata Sahu Listen Download, Swargare Nuhen Odia Gita Download, Swargare Nuhen Odia Gaana Download
mamatasongdownload
https://www.orissapost.com/murmu-dials-sonia-pawar-mamata-seeking-support/
Droupadi Murmu dials Sonia, Pawar, Mamata seeking support
Jun 24, 2022 - Droupadi Murmu Friday called up Sonia Gandhi, NCP's Sharad Pawar, Mamata, and sought their support for her candidature.
droupadi murmuseeking supportdialssoniamamata
https://www.indiatoday.in/india/law-news/story/mamata-banerjee-bengal-assembly-election-results-loss-refuses-to-resign-as-trinamool-congress-term-ends-what-happens-next-2907044-2026-05-05
Bengal assembly election results 2026: Mamata Banerjee refuses to resign as Trinamool Congress led...
May 5, 2026 - Mamata Banerjee has refused to resign after the BJP's victory in Bengal, alleging the election was forcibly captured. With the government's term ending on May...
bengal assembly electionmamata banerjeetrinamool congressresultsrefuses
https://www.anandabazar.com/west-bengal/lakshmir-bhandar-has-received-skoch-award-mamata-banerjee-tweets-dgtl/cid/1380178
Mamata Banerjee | Lakshmir Bhandar has received Skoch award, Mamata Banerjee tweets dgtl -...
mamata banerjeehas receivedskochawardtweets
https://apnlive.com/topic/mamata-banerjee/
Mamata Banerjee Latest News, Photos, Videos on Mamata Banerjee
KHABAR HAI TO DEKHEGI
mamata banerjeelatest newsphotosvideos
https://www.tr.freelancer.com/u/sara101
Mamata S. Profile | Freelancer
Mamata S. is a Freelancer specialising in Copywriting and Internet Marketing in India.
mamataprofilefreelancer
https://www.cityairnews.com/content/cm-mamata-announces-resolution-to-remove-bjp-from-power-at-centre-after-winning-bengal-polls
CM Mamata announces resolution to remove BJP from power at Centre after winning Bengal polls
Trinamool Congress supremo and West Bengal Chief Minister, Mamata Banerjee, on Sunday announced a new 'resolution' to remove the Bharatiya Janata Party...
at centrecmmamataannouncesresolution
https://dailyworld.in/newsalert/bjp-trying-to-include-illegal-voters-from-bihar-rajasthan-haryana-up-in-bengal-rolls-cm-mamata-banerjee-at-chandrakona-poll-rally-pti-667341.html
BJP trying to include illegal voters from Bihar, Rajasthan, Haryana, UP in Bengal rolls: CM Mamata...
BJP trying to include illegal voters from Bihar, Rajasthan, Haryana, UP in Bengal rolls: CM Mamata Banerjee at Chandrakona poll rally. PTI| Dailyworld.in
bjptryingincludeillegalvoters
https://indianexpress.com/article/live-news/top-news-today-daily-briefing-uae-exits-opec-gains-autonomy-10661409/
OPEC Shaken as UAE Quits Oil Bloc While Mamata Faces Final 'Didi vs Modi' Showdown in Bengal
Apr 29, 2026 - In today's edition: Manipur Deputy Chief Minister Losii Dikho interview, UN's stance on West Asia and India, and more
opecshakenuaequitsoil
https://articles.thelocalreport.in/unenacted-presidential-rules-mamata-on-transfers/
'Unenacted presidential rules': Mamata on transfers - THE LOCAL REPORT ARTICLES
Mar 20, 2026 - India News: KOLKATA: Election Commission's mass transfer of senior IAS and IPS officers within Bengal was a form of "unpromulgated President's Rule", CM Mamata...
the localpresidentialrulesmamatatransfers
https://www.anirbansaha.com/tag/mamata-bannerjee/
Mamata Bannerjee Archives - Anirban Saha
mamataarchivessaha
https://oxfordliteraryfestival.org/authors-speakers/20/bidisha
Bidisha Mamata | Oxford Literary Festival
literary festivalmamataoxford
https://therahnuma.com/mamata-banerjee-loses-again-to-suvendu-adhikari-this-time-from-bhabanipur/
Mamata Banerjee loses again to Suvendu Adhikari, this time from Bhabanipur - The Rahnuma Daily
May 5, 2026 - Kolkata, May 4 (IANS) Outgoing Chief Minister Mamata Banerjee was defeated on Monday by the Leader of the Opposition in the West Bengal assembly, Suvendu...
mamata banerjeesuvendu adhikarilosestimedaily
https://enewsroom.in/narendra-modi-didi-o-didi-bengal-mamata/
What the attack on Mamata could not do for TMC, Didi-O-Didi remark did
Apr 4, 2021 - The Didi-o-Didi remark on Mamata Banerjee by PM Narendra Modi did not go well in Bengal which has 49 percent of 7.2 crore electorate is women
what theattackmamatacouldtmc
https://www.newsheads.in/latest-news/sources/mamata-urges-pledge-to-eradicate-open-defecation-menace-article-47960
Mamata urges pledge to eradicate open defecation menace
Nov 19, 2018 - West Bengal Chief Minister Mamata Banerjee on Monday called for a pledge to eradicate the menace of open defecation on the occasion of World Toilet Day.
open defecationmamataurgespledgeeradicate
https://rajatsharma.in/can-mamata-banerjee-unite-the-opposition/
Rajat Sharma Can Mamata Banerjee unite the opposition? - Rajat Sharma
Dec 2, 2021 - Trinamool Congress supremo and West Bengal chief minister Mamata Banerjee announced in Mumbai on Wednesday that she has initiated efforts to provide a new and...
mamata banerjeethe oppositionsharmaunite
https://asianatimes.com/mamata-devi-lost-her-membership-post-conviction/
Mamata Devi-loses-membership-post-conviction-from-congress
Oct 16, 2023 - Legal analysts claim that Mamta Devi has been found guilty by Additional District and Sessions Judge 4 Pawan Kumar of the MP-MLA Court.
post convictionmamatadevilosesmembership
https://m.dailyhunt.in/news/india/english/my+kolkata+the+telegraph-epaper-mkoltgph/highstakes+bhabanipur+vote+suvendu+circles+mamatas+home+turf+no+direct+contact+in+prestige+war-newsid-n710468937
High-stakes Bhabanipur vote: Suvendu circles Mamata's home turf, no direct contact in prestige war...
Apr 30, 2026 - Bhabanipur, TMC supremo Mamata Banerjee's safest political fortress and the BJP's most audacious battlefield in Bengal, voted on Wednesday in a contest heavy wi
high stakeshome turfdirect contactvotecircles
https://english.bombaysamachar.com/top-news/rahul-gandhis-april-23-bengal-visit-cancelled-congress-blames-mamata-banerjees-party/?amp=1
Rahul Gandhi's April 23 Bengal Visit Cancelled, Congress Blames Mamata Banerjee's Party | English...
Apr 22, 2026 - The Congress has claimed Bengal's ruling Trinamool refused permission for Rahul Gandhi's rally in Kolkata ahead of voting Thursday for the first phase of the...
rahul gandhimamata banerjeeaprilbengalcancelled