Robuta

https://www.youtube.com/@ikatanbidanindonesia1249 Indonesian Midwives Association - YouTube Share your videos with friends, family, and the world indonesianmidwivesassociationyoutube https://www.soulmidwives.co.uk/ The Soul Midwives Portal Jul 20, 2025 - Welcome to the official website of Felicity Warner and the Soul Midwives School. Learn more about our training and find a Soul Midwife here. the soulmidwivesportal https://belgianmidwivesassociation.be/ Home – Belgian Midwives Association belgianmidwivesassociation https://snmcseychelles.com/ Seychelles Nurses and Midwives Council nurses and midwivesseychellescouncil https://canadianmidwives.org/ Midwives for everyone, everywhere - Canadian Association of Midwives for everyone everywheremidwivescanadianassociation https://www.bls.gov/ooh/healthcare/nurse-anesthetists-nurse-midwives-and-nurse-practitioners.htm Nurse Anesthetists, Nurse Midwives, and Nurse Practitioners : Occupational Outlook Handbook: : U.S.... Nurse anesthetists, nurse midwives, and nurse practitioners coordinate patient care and may provide primary and specialty healthcare. occupational outlook handbooknurse anesthetistsmidwivespractitioners https://southdenverobgyn.com/ Home South Denver OB/GYN & Midwives Apr 30, 2026 - OnPoint Internal Medicine at Broomfield is composed of physicians and healthcare professionals devoted to promoting life-long health using evidence-based... south denverob gynmidwives https://healthtimes.com.au/ HealthTimes: jobs, courses, CPD for nurses midwives and allied health professionals HealthTimes is the premier career, education and professional development resource for Australian Health professionals. cpd for nursesallied healthjobscourses https://grnmainfonet.com/login Ghana Registered Nurses and Midwives Association nurses and midwivesghanaregisteredassociation https://tamilnadunursingcouncil.com/ Tamil Nadu Nurses & Midwives Council tamil nadunurses midwivescouncil https://onmrc.in/ Odisha Nurses and Midwives Registration Council (ONMRC) nurses and midwivesodisharegistrationcouncil https://emwa.org.et/ Midwives Association midwivesassociation https://internationalmidwives.org/who-we-are/ Who We Are | International Confederation of Midwives who we areinternationalconfederationmidwives https://midwife.org/ Home - American College of Nurse Midwives Nov 21, 2025 - ACNM supports Certified Nurse-Midwives and Certified Midwives through education, advocacy, and professional growth. american collegenursemidwives https://millionmore.org/ One Million More Midwives Together we can make it happen one millionmidwives https://onlinetnnmc.org/ Tamil Nadu Nurses and Midwives Council nurses and midwivestamil naducouncil https://afghanmidwives.org/ Afghan Midwives Association – Strengthening Midwifery in Afghanistan afghanmidwivesassociationstrengtheningmidwifery https://caribbeanregionalmidwivesassociation.com/ Caribbean Regional Midwives Association | We Care For You we care forcaribbeanregionalmidwivesassociation https://www.albertamidwives.org/ Home | College of Midwives of Alberta home collegemidwivesalberta https://www.europeanmidwives.com/ European Midwives Association May 8, 2026 - We are a non-profit and non-governmental organisation of midwives, representing midwifery organisations and associations from the member states. europeanmidwivesassociation https://soma.so/ Somali Midwives Association – SOMA somalimidwivesassociation https://internationalmidwives.org/media-center/ Media Center | International Confederation of Midwives Sep 30, 2025 - The ICM Media Centre is a dedicated resource for journalists and partners seeking news, press releases, information, expert comment, and visual material about... media centerinternationalconfederationmidwives https://acnm.midwifejobs.com/ American College of Nurse-Midwives (ACNM), MidwifeJobs|Find Your Career Here American College of Nurse-Midwives (ACNM) - Find your next career at MidwifeJobs. Check back frequently as new jobs are posted every day. find your careeramerican collegenurse midwives https://maltamidwivesassociation.com/ Malta Midwives Association - Home Our Mission is to advance the clinical and professional practice of midwives in Malta and Gozo. maltamidwivesassociation https://www.communitymidwivesoftoronto.ca/ Community Midwives of Toronto - Home Welcome to Community Midwives of Toronto! We very much look forward to working with you and your family during your pregnancy, birth and postnatal care. There... communitymidwivestoronto https://doh.wa.gov/zh-hant/node/33830 Licensing Information For Midwives | Washington State Department of Health Fee Schedule | Understanding your Application | Process for Approving/Denying Applications | Additional Licensing Information licensing informationwashington statedepartment ofmidwiveshealth https://www.legislation.gov.uk/cy/apni/1929/6/2006-01-01 Midwives and Nursing Homes Act (Northern Ireland) 1929 An Act to amend the Midwives (Ireland) Act, 1918, and to provide for the registration and inspection of nursing homes, and for purposes connected therewith. nursing homesnorthern irelandmidwivesact https://cempaka-health.blogspot.com/2015/03/midwives-at-china-built-hospital-bring.html Cempaka Health, Welfare and Society: Midwives at China-built hospital bring solace to Somali women Want China Times , Xinhua 2015-03-16 The Banadir Hospital. (Internet photo) When China constructed the maternity wing of Somalia's... https://www.magnific.com/free-vector/flat-midwives-day-illustration_13448162.htm Flat midwives day illustration | Free Vector Download this free vector of Flat midwives day illustration and explore millions of professional vectors on Magnific. flatmidwivesdayillustrationfree https://ltu.diva-portal.org/smash/record.jsf?pid=diva2:976022 Midwives' experience of encountering women with posttraumatic stress symptoms after childbirth midwivesexperienceencounteringwomen https://ifp.nyu.edu/2022/journal-article-abstracts/dar-13576/ Midwives' knowledge and perceived barriers to screening alcohol use among pregnant women in a... Dec 30, 2022 - Abstract Introduction Alcohol consumption during pregnancy can produce multiple damaging outcomes to the foetus, commonly referred to as fetal alcohol https://www.westcountrymidwives.com/ Midwifery and wellness services | West Country Midwives | Canada West Country Midwives offers midwifery services in West Central Alberta wellness serviceswest countrymidwiferymidwivescanada https://www.orangeblossomwomensgroup.com/ Orange Blossom Women's Group: Board Certified OB-GYNS, Midwives & Advanced Nurse Practitioners: New... https://hexi.ox.ac.uk/experiences-nurses-midwives-allied-health-professionals-research/abiXa Nurses, midwives & allied health professionals in research - Abi - nurses, midwives and allied... allied health professionalsnurses midwivesin researchabi https://www.cca.hawaii.gov/pvl/programs/midwife/statute-rules-chapter/ Midwives Statute/Rule Chapter - DCCA Hawaii midwivesstatuterulechapterdcca https://odysee.com/%24/embed/%40CultivateElevate%3Ae2%2Fstonefruits%3Ab?r=2MMAYozTs9jLjK43NNmyn9YL8aDYQLfZ Eating Stone Fruits, Midwives, and Healthy Sleep Today we dabble into the healing properties of b17 from the seeds of stone fruit, midwives, led light dangers, and healthy sleep solutions. stone fruitseatingmidwiveshealthysleep https://azmidwives.blogspot.com/2009/08/flu-vaccine-seasonal-and-h1n1-q.html The Midwives of Bethany Womens Healthcare: Flu Vaccine (seasonal and H1N1) Q&A Bethany Womens Healthcare's midwives and lactation consultant share their thoughts, education, adventures, and more! https://annerley.otandp.com/ Annerley - OT&P's Midwives Clinic p sannerleyotmidwivesclinic https://html5-player.libsyn.com/embed/episode/id/33969957/height/84/theme/custom/thumbnail/no/direction/backward/render-playlist/no/custom-color/353a4f/ Ep. 420: The Corporate Democrats and the Mainstream News Media were the Midwives For Donald Trump's... https://wessexindependentmidwives.co.uk/ Wessex Independent Midwives | Private midwives in Dorset, Hampshire, Wiltshire Wessex Independent Midwives, private midwives that offer services for antenatal care, labour and birth care, postnatal care, tongue tie, pregnancy yoga wessexindependentmidwivesprivatedorset https://azmidwives.blogspot.com/2009/07/welcome.html The Midwives of Bethany Womens Healthcare: Welcome! Welcome to the Bethany Women's Healthcare Midwifery blog! As we evolve our midwifery practice, it's out goal to keep technology out of the ... midwivesbethanywomenshealthcarewelcome https://law.lis.virginia.gov/vacodefull/title32.1/chapter5/article4/ Code of Virginia Code - Article 4. Midwives code of virginiaarticlemidwives https://gambia.unfpa.org/en/news/seventeen-midwives-crr-gain-life-saving-skills-through-unfpa-supported-training UNFPA The Gambia | Seventeen Midwives in CRR Gain Life-Saving Skills Through UNFPA-Supported... In The Gambia, the Central River Region (CRR) continues to contend with one of the highest maternal mortality rates. Twenty maternal deaths were reported from... https://www.inspectioncopy.elsevier.com/book/details/9780702076428 Myles Textbook for Midwives - Edition 17 - Edited by Jayne E. Marshall, FRCM, PFHEA, PhD, MA,... Instructors may request a copy of this title for examination. https://gateway.euro.who.int/en/indicators/hlthres_216-professional-nurses-and-midwives-employed-by-hospital-in-fte-total-number/ Professional nurses and midwives employed by hospital in FTE, total number - European Health... Indicator: Professional nurses and midwives employed by hospital in FTE, total number, Categories: Hospital Employment, FTE, nurses and midwives https://suomenkatiloliitto.fi/ Suomen Kätilöliitto | Finlands Barnmorskeförbund ry | The Federation of Finnish Midwives May 10, 2026 - Suomen Kätilöliitto ry on Suomen vanhimpia alan ammatillis-aatteellisia järjestöjä ja sillä on pitkät perinteet kätilöitä yhdistävänä tahona. the federationsuomenfinlandsryfinnish https://jasonmicheli.substack.com/p/hitmen-and-midwives-session-three/comments Comments - Hitmen and Midwives: Session Three Preaching should aim at a promise that pledges a future that is otherwise commentshitmenmidwivessessionthree https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0133524 Costs of Planned Home vs. Hospital Birth in British Columbia Attended by Registered Midwives and... Background Home birth is available to women in Canada who meet eligibility requirements for low risk status after assessment by regulated midwives. While UK... https://repository.gatech.edu/entities/publication/d716c5d3-cbe3-431a-9a95-0b50162dab7e Midwives, Housewives and Nationalism: Egypt in the Making of Colonial Medicine Speaker Hibba Abugideri is an historian of postcolonial and Islamic feminism and women in the Middle East. Currently an assistant professor at Villanova... in the makingmidwiveshousewivesnationalismegypt https://birthhour.libsyn.com/podcast/919-hospital-birth-with-midwives-turned-cesarean-birth-abbey-hollett The Birth Hour - A Birth Story Podcast: 919| Hospital birth with Midwives Turned Cesarean Birth -... Links: Today's episode is sponsored by Motif Medical. See how you can get Motif's Luna or Aura breast pumps covered through insurance at . (comes free with KYO... the birtha story https://www.ontariomidwives.ca/ Ontario Midwives | AOM ontariomidwivesaom https://sacredbirthfl.com/ Orlando Midwives: Supporting Natural Birth Options in FL Mar 31, 2026 - Discover the empowering care provided by our midwives in Orlando, FL. Our dedicated team of midwives at Sacred Birth is committed to supporting women... natural birthorlandomidwivessupportingoptions https://data.mendeley.com/datasets/pzp9k4j4yy/1 Data of Nurses/Midwives' Personality Traits and Work Experience in Patient Safety - Mendeley Data This study aimed to address the following research questions: 1. Do the safety attitudes of nurses and midwives correlate with any or all of the following... https://mobilemidwives.co.uk/ Mobile Midwives CIC Online consultations with experienced independent midwives. Pregnancy support, guidance and a directory of private and independent midwives. mobilemidwivescic https://melbournedoula.blogspot.com/2010/05/planned-homebirths-in-victoria-1995.html Melbourne Doula: A Study on Planned Homebirths with Independent Midwives in Victoria Planned homebirths in Victoria, 1995-1998 Parratt J, Johnston J. Abstract This paper reports and comments on quantitative aspects of 4... a study https://find.library.upenn.edu/catalog/9955885373503681 Nurses, Midwives and Health Visitors Act 1979 National Board for Nursing, Midwifery and Health... Access 'Nurses, Midwives and Health Visitors Act 1979 National Board for Nursing, Midwifery and Health Visiting for Scotland account 1993-94 account prepared... nurses midwiveshealth visitors https://oru.diva-portal.org/smash/record.jsf?pid=diva2:548475 A Swedish study of midwives' and nurses' experiences when women are diagnosed with a missed... https://central.midwife.org.nz/ Home - Central New Zealand College of Midwives -Central New Zealand College of Midwives Dec 7, 2020 - Central New Zealand College of Midwives Sites site home centralnew zealandcollege ofmidwives https://azmidwives.blogspot.com/2010/07/guest-post-children-and-chiropractic.html The Midwives of Bethany Womens Healthcare: Guest post: Children and Chiropractic Care This is the first in a series of posts about chiropractic care by Dr. Ashley. I had no idea that there were so many benefits to chiropractic... children and chiropractic https://www.gov.uk/hmrc-internal-manuals/vat-health/vathlt2350 VATHLT2350 - Nurses, midwives and health visitors: Problems arising from the exemption for... nurses midwiveshealth visitors https://www.justgiving.com/fundraising/sheffield-arm Hilary Rosser is fundraising for The Association of Radical Midwives Help Hilary Rosser raise money to support The Association of Radical Midwives for thehilaryrosserfundraisingassociation https://www.vatican.va/content/francesco/en/events/event.dir.html/content/vaticanevents/en/2025/2/6/ostetrica-catanzaro.html To Members of the Order of Midwives of Catanzaro, Cosenza, Crotone and Vibo Valentia - Calendar of... To Members of the Order of Midwives of Catanzaro, Cosenza, Crotone and Vibo Valentia - Calendar of Activities members of the order https://api.parliament.uk/historic-hansard/commons/1990/may/01/nurses-and-midwives Nurses and Midwives (Hansard, 1 May 1990) Nurses and Midwives (Hansard, 1 May 1990) nurses and midwiveshansardmay https://api.parliament.uk/historic-hansard/written-answers/1994/apr/22/nurses-and-midwives Nurses and Midwives (Hansard, 22 April 1994) Nurses and Midwives (Hansard, 22 April 1994) nurses and midwiveshansardapril https://www.birthpartnershipmidwives.com/ Birth Partnership Midwives | midwife in calgary | Calgary, AB, Canada Founded in 1996, Birth Partnership Midwives empowers families through safe and respectful midwifery care in Calgary and area. We love our work and share a... in calgarybirthpartnershipmidwivesmidwife https://tridentine-mass.blogspot.com/2023/08/saint-raymond-nonnatus-1240-ad-patron.html TRADITIONAL LATIN MASS PROPERS IN ENGLISH: Saint Raymond Nonnatus, (1240 A.D.) Patron of midwives,... Patron of midwives, pregnant women, unborn children, and women in labor. In Mexico, he is invoked for silence and protection against... https://www.tdlr.texas.gov/news/2021/12/10/midwives-educational-summit/ Midwives Educational Summit | TDLR News and Updates news andmidwiveseducationalsummittdlr https://www.commerce.alaska.gov/web/cbpl/ProfessionalLicensing/Midwives/BoardMeetingSchedule Board Meeting Schedule, Midwives, Professional Licensing, Division of Corporations, Business and... Board Meeting Schedule, Midwives, Professional Licensing, Division of Corporations, Business and Professional Licensing board meeting scheduledivision of corporationsprofessional licensingmidwives https://www.magnific.com/free-vector/flat-midwives-day-illustration_13448160.htm Flat midwives day illustration | Free Vector Download this free vector of Flat midwives day illustration and explore millions of professional vectors on Magnific. flatmidwivesdayillustrationfree https://nmcwatch.org.uk/ NMCWatch - Empowering nurses and midwives through professional investigations with peer support. nurses and midwivesempowering https://sarahhenderson.substack.com/p/mandated-cultural-humility-for-new Mandated Cultural Humility for New Zealand Midwives cultural humilityfor newmandatedzealandmidwives https://find.library.upenn.edu/catalog/9948634623503681 The compleat practice of men and women midwives : Or The true manner of assisting a woman in... Access 'The compleat practice of men and women midwives : Or The true manner of assisting a woman in child-bearing: Illustrated with a considerable number of... https://today.uic.edu/uic-nursing-midwives-named-2022-acnm-fellows/ UIC Nursing midwives named 2022 ACNM fellows | UIC today acnm fellowsuicnursingmidwivesnamed https://americareads.blogspot.com/2015/02/pg-69-sally-hepworths-secrets-of.html Campaign for the American Reader: Pg. 69: Sally Hepworth's "The Secrets of Midwives" Featured at the Page 69 Test: The Secrets of Midwives by Sally Hepworth . About the book , from the publisher: Three generations of wome... https://app.acuityscheduling.com/schedule/338bef4c/?categories%5B%5D=Childbirth%20Education%20Courses Schedule Appointment with Malta Midwives Association Schedule your appointment online Malta Midwives Association schedule appointmentmaltamidwivesassociation https://azmidwives.blogspot.com/2009/12/flugov.html The Midwives of Bethany Womens Healthcare: Flu.Gov The Flu.gov website has easy-to-read information regarding the flu, vaccination, etc. It also gives H1N1 updates and has a vaccination locat... midwivesbethanywomenshealthcareflu https://pmc.ncbi.nlm.nih.gov/articles/PMC4944581/ Comparative Cost of Early Infant Male Circumcision by Nurse-Midwives and Doctors in Zimbabwe - PMC Early infant male circumcision (EIMC) conducted by nurse-midwives using the AccuCirc device was safe and less costly per procedure than when conducted by... https://www.nber.org/digest/oct16/licensing-midwives-and-maternal-mortality Licensing of Midwives and Maternal Mortality | NBER maternal mortalitylicensingmidwivesnber https://www.nursesandmidwivesgy.com/ Home | Nurses & Midwives GY nurses midwivesgy https://kidshealth.org/AetnaBetterHealthKentucky/en/parents/hcp-midwives.html Health Care Providers: Midwives (for Parents) - Aetna Better Health of Kentucky (Medicaid) A midwife specializes in female reproductive health care needs such as prenatal care, labor, delivery, postpartum care, and newborn care for low-risk... health care providersfor parentsmidwives https://azmidwives.blogspot.com/ The Midwives of Bethany Womens Healthcare Bethany Womens Healthcare midwivesbethanywomenshealthcare https://shop.elsevier.com/books/mothers-and-midwives/thompson/978-0-7506-8776-8 Mothers and Midwives - 1st Edition | Elsevier Shop Purchase Mothers and Midwives - 1st Edition. Print Book. ISBN 9780750687768 mothersmidwiveseditionelseviershop https://pmc.ncbi.nlm.nih.gov/articles/PMC5223536/ Prevalence of burnout, depression, anxiety and stress in Australian midwives: a cross-sectional... The health and wellbeing of midwives are important considerations for workforce retention and quality care. The occurrence and relationships among mental... anxiety and stress https://www.midwivesformidwives.org/ Home | Midwives for Midwives Aug 6, 2025 - Welcome to Midwives for Midwives Strengthening the midwifery model of care, the world over. MFM was a non-profit organization run by a global collective midwives https://nursing.georgetown.edu/news-story/changing-the-perception-of-midwives-one-hospital-at-a-time/ Changing the Perception of Midwives - Nursing School - Georgetown Apr 28, 2025 - Changing the Perception of Midwives: One Hospital at a Time - Learn how Georgetown Nursing is working to change the perception of midwives and promote... nursing schoolchangingperceptionmidwivesgeorgetown https://jasonmicheli.substack.com/p/hitmen-and-midwives-session-two/comments Comments - Hitmen and Midwives: Session Two Every Sermon Needs an "I" commentshitmenmidwivessessiontwo https://api.parliament.uk/historic-hansard/commons/1897/may/20/midwives-registration-bill MIDWIVES' REGISTRATION BILL. (Hansard, 20 May 1897) MIDWIVES' REGISTRATION BILL. (Hansard, 20 May 1897) midwivesregistrationbillhansardmay https://presentinglenore.blogspot.com/2009/08/book-club-report-midwives-by-chris.html?showComment=1249362949227 Presenting Lenore: Book Club Report: Midwives by Chris Bohjalian I met with my new book club for the third time this past week to discuss Midwives, a book from 1998 set in the early 1980s (and an Oprah Boo... book clubby chrispresentinglenorereport https://www.mpg.de/4650664/stellar_midwives?c=2249 Stellar midwives | Max-Planck-Gesellschaft Stars and their planets are born when giant clouds of interstellar gas and dust collapse. What exactly happens in such cosmic delivery rooms? What are the... max planckstellarmidwivesgesellschaft https://journals.plos.org/plosone/article/comments?id=10.1371/journal.pone.0196076 Adherence to hyperbilirubinemia guidelines by midwives, general practitioners, and pediatricians in... Severe hyperbilirubinemia, which may result in kernicterus, is seen more frequently in low and middle-income countries, such as Indonesia, than in high-income... general practitionersadherencehyperbilirubinemiaguidelines https://sudburymidwives.com/ Sudbury Community Midwives sudburycommunitymidwives https://ligainan.org/ Liga Inan - Connecting pregnant women & their midwives Liga Inan is using mobile phones to connect expectant mothers with health providers in Timor-Leste to improve the likelihood of a healthy pregnancy and birth. pregnant womenligainanconnectingmidwives https://www.holisticmidwiferyny.net/ Holistic Homebirth Midwives in NYC & Long Island - Holistic Midwifery NY Jul 3, 2024 - We are a holistic midwifery practice offering care in the New York City and Long Island areas. We specialize in home birth and holistic gynecologic care. in nyclong islandholistichomebirthmidwives https://bigfuture.collegeboard.org/careers/nurse-midwife/income-and-hiring Nurse Midwives Income and Hiring - BigFuture Career Search See income and job outlook statistics for Nurse Midwives. nurse midwivesincomehiringbigfuturecareer https://reliefweb.int/report/pakistan/pakistan-empowering-midwives-empower-women In Pakistan, empowering midwives to empower women - Pakistan | ReliefWeb News and Press Release in English on Pakistan about Health; published on 20 Nov 2017 by UNFPA empower womenpakistanempoweringmidwivesreliefweb https://sfrcontests.blogspot.com/2017/04/anthology-submission-call-space-marine.html?m=0 SFR Brigade: Anthology Submission Call: Space Marine Midwives #spaceopera #scifi There's currently a submission call for a new anthology of Space Marine Midwives. While the Brigade is not involved with or endorsing it, we... sfr brigadesubmission callspace marineanthologymidwives https://www.bbb.org/us/ut/lapoint/profile/midwives/uintah-basin-midwives-1166-90050123 Uintah Basin Midwives | BBB Business Profile | Better Business Bureau BBB Accredited since 3/19/2025. Midwives in Lapoint, UT. See BBB rating, reviews, complaints, get a quote and more. bbb businessuintahbasinmidwivesprofile https://careers.umich.edu/browse-jobs/departments/318170 Browsing : MM CW-Triage Midwives | U-M Careers browsingmmcwtriagemidwives https://jasonmicheli.substack.com/p/hitmen-and-midwives-92e Hitmen and Midwives - by Jason Micheli - Tamed Cynic Thesis #5 with Dr. Ken Jones hitmenmidwivesjasonmichelitamed https://reliefweb.int/report/south-sudan/op-ed-midwives-south-sudan-critical-health-anchors-every-crisis Op-Ed: Midwives in South Sudan: Critical Health Anchors in Every Crisis - South Sudan | ReliefWeb News and Press Release in English on South Sudan about Health and Protection and Human Rights; published on 4 May 2025 by UNFPA op edsouth sudan