Robuta

https://www.energy.gov/indianenergy/articles/new-initiatives-seek-address-tribal-electricity-access-and-reliability-report
Report Highlights Past DOE Investment Impacts, Ongoing Barriers, and Opportunities to Support Tribal Energy Goals
new initiativeselectricity accessseekaddresstribal
https://niwa.co.nz/news/electricity-conversion-project-takes-top-prize-auckland-science-fair
A suite of projects that ranged from whether toothpaste’s a scam to capturing air, to human superpowers made up the 206 entries at this year’s NIWA...
science fairelectricityconversionprojecttakes
https://www.grantthornton.de/en/insights/2025/new-electricity-price-allowance-strompreispauschale-2026-changes-for-employers/
Starting from 2026, a new electricity price flat rate will apply for reimbursing electricity costs when charging electric and hybrid vehicles. Overview of...
new electricitypriceallowancechanges
https://www.cmegroup.com/notices/clearing/2017/06/Chadv17-200.html
Use the search tool to access all Notices for CME Group exchanges, CME, CBOT, NYMEX, and COMEX.
new productsummaryinitiallistingfour
https://www.ndtv.com/food/the-new-kind-of-protein-created-from-air-and-electricity-1731757
Scientists in Finland claim that they have been able to successfully create food from thin air, using components such as electricity, CO2 and a few added...
newkindproteincreatedair
https://www.nextbigfuture.com/2008/03/direct-conversion-of-radiation-into.html
Liviu Popa-Simil, former Los Alamos National Laboratory nuclear engineer and founder of private research and development company LAVM and Claudiu Muntele, of
direct conversioncarbon nanotubesradiationelectricityusing
https://marketbusinessnews.com/electricity-producing-bacteria/194340/
Scientists have managed to identify electricity-producing bacteria using a new microfluidic process. Their process could be used in power generation.
researchersidentifyelectricityproducingbacteria
https://www.azernews.az/region/212527.html
Electricity consumption reached a new record high for 2023 on Wednesday, climbing to 59.10 GW at 4.45 pm local time, according to grid operator Terna, Azernews...
electricity consumptionreachesnewhighitaly
https://cfotech.co.nz/story/a-new-generation-of-energy-resilience-a-smarter-approach-to-new-zealand-electricity
New Zealand boosts energy resilience by smarter use of existing electricity, smart tech, and local generation to ease grid pressure and cut costs.
new generationenergy resiliencesmarterapproach
https://www.nyenergyratings.com/
Compare, Shop and Save on New York Electricity and Natural Gas Service by Comparing New York Electricity and Natural Gas Companies Side by Side
new yorkenergy ratingscompare companiessave
https://www.energysage.com/local-data/electricity-cost/nj/bergen-county/new-milford/
How much does electricity cost in New Milford, NJ? Learn what average electric rates and electric bills look like in 2026.
compare newmilford njelectricity ratesenergysage
https://www.naturalnews.com/2024-09-06-green-new-deal-increase-energy-costs-2800percent.html
The phase-out of earth-based fuels like oil and gas is in full swing. And in the not-too-distant future, average American households could end up paying energy...
get readysky highelectricity billsgreennew
https://www.trend.az/business/3665840.html
create newelectricity generationazerenergyjscsource
https://physicsworld.com/a/new-experiments-on-static-electricity-cast-doubt-on-previous-studies-in-the-field/
Nov 13, 2025 - Bulk conductivity may have been hiding the dynamics of surface charge transfer, say researchers
static electricitynewexperimentscastdoubt
https://indianexpress.com/article/cities/pune/msedcl-introduces-new-system-for-timely-new-electricity-connections-10457048/
Commenced from January 1, this year, MSEDCL officials are confident that these measures will eliminate delays in providing new electricity connections.
new systemmsedclintroducestimelyelectricity
https://www.cbsnews.com/newyork/news/new-york-utility-cost-spike/
The increase is due to the global spike in natural gas prices.
new york statepublic service commissionelectricity priceswarnscould
https://www.energysage.com/local-data/electricity-cost/nh/
How much does electricity cost in New Hampshire? Learn what average electric rates and electric bills look like in 2026.
new hampshire electricitycompareratesenergysage
https://www.energy.gov/articles/doe-releases-new-report-evaluating-increase-electricity-demand-data-centers
Domestic Energy Usage from Data Centers Expected to Double or Triple by 2028, DOE Continues to Accelerate Development and Deployment of Solutions to Meet...
new reportelectricity demanddoereleasesevaluating
https://esgnews.com/marks-spencer-launches-new-supply-chain-program-to-accelerate-renewable-electricity-uptake/
Nov 20, 2025 - M&S launches RE:Spark to expand renewable electricity adoption across fashion suppliers in Asia and Turkey.
supply chainmarksampspencerlaunches
https://www.popsci.com/new-device-uses-electricity-to-stop-bleeding/
Internal bleeding is tricky to stop, and can be life-threatening. Now, a group of researchers is trying a new approach: Pass an electrical current through a...
new devicewoulduseelectricityplug
https://newsociety.com/blog/2023/05/24/reducing-your-electricity-generation-and-heating/
Aug 12, 2025 - We have relatively little control over how our electricity is generated, except to lobby governments and power companies. But some of us have the option of...
electricity usenew societyreducingampheating
https://zenodo.org/records/6345571
New Jersey is among a vanguard of states pursuing a transition to a 100% carbon-free electricity system. The goal of this study is to provide a detailed...
new jerseypathwaycarbonfreeelectricity
https://www.binghamton.edu/news/story/5213/new-device-from-binghamton-university-researchers-generates-electricity-from-moisture-in-the-air
The paper-based wearable device would provide sustained high-efficiency power output for sensors, drug delivery or electrical stimulation.
new deviceelectricitymoistureairbinghamton
https://www.rutgers.edu/news/cows-and-solar-panels-new-jersey-first-project-melds-farming-electricity-generation
solar panelsnew jerseycowsfirstproject
https://bravenewcoin.com/insights/illegal-bitcoin-mining-drains-over-100-million-from-malaysian-electricity-provider
Tenaga Nasional Berhad (TNB), Malaysia's main power utility, has disclosed significant financial losses linked to unlawful Bitcoin mining surpassing 440...
bitcoin miningillegaldrainsmillionmalaysian
https://ground.news/article/new-electricity-law-should-boost-renewable-energies
The electricity sector expects the decrease of the subsidy to natural gas and the execution of other measures so that alternative renewable energies have the...
new electricityrenewable energieslawboost
https://futurism.com/new-materials-conduct-electricity-speed-light
Researchers have developed two-dimensional material with breakthrough electric and magnetic properties.
new materialsconductelectricityspeedlight
https://itbrief.co.nz/story/a-new-generation-of-energy-resilience-a-smarter-approach-to-new-zealand-electricity
New Zealand boosts energy resilience by smarter use of existing electricity, smart tech, and local generation to ease grid pressure and cut costs.
new generationenergy resiliencesmarterapproach
https://www.cityam.com/national-grid-electricity-system-operator-to-allow-energy-firms-to-connect-new-projects/
Energy firms will be able to build their own connections to the grid, confirms National Grid's electricity system operator.
national gridelectricity systemoperatorallowenergy
https://lfpress.com/news/local-news/ontarios-new-electricity-rates-kick-in-nov-1-heres-what-changes
new electricityrateskicknov
https://www.eia.gov/todayinenergy/detail.php?id=43635
Energy Information Administration - EIA - Official Energy Statistics from the U.S. Government
new york fallselectricity demanddaily
https://notjustacar.com/audi-rolling-out-new-v6-diesel-with-a-jolt-of-electricity/
Nov 27, 2025 - Audi's new 3.0L V6 TDI for the Q5/A6 uses MHEV plus and an electric compressor to kill turbo lag and deliver instant, V8-like torque (299 hp).
audirollingnewdieseljolt
https://skepticalscience.com/100-percent-renewable-power.html
A new paper: 100% clean and renewable wind, water, and sunlight (WWS) all-sector energy roadmaps for the 50 United States by Jacobson et al 2015 describes the...
new papershowsrenewablessupply
https://www.geeky-gadgets.com/audis-new-suspension-generates-electricity-2016-08-11/
One of the keys to expanding the driving range of a hybrid or electric vehicle on battery power alone is to capture as much electricity as possible for
geeky gadgetsaudinewsuspensionelectricity
https://www.weforum.org/stories/2026/02/how-electricity-providers-are-adapting-to-the-global-data-centre-build-out/
Electricity providers are fundamental to the global AI push, and are adapting their business models to cater to growing demand caused by data centres.
new dataelectricityprovidersadaptingcentres
https://telconews.co.nz/story/a-new-generation-of-energy-resilience-a-smarter-approach-to-new-zealand-electricity
New Zealand boosts energy resilience by smarter use of existing electricity, smart tech, and local generation to ease grid pressure and cut costs.
new generationenergy resiliencesmarterapproach
https://www.bdcnetwork.com/home/news/55160597/a-new-light-from-dyson-can-last-for-22-years-and-uses-just-90w-of-electricity
Dyson is mostly known for its (expensive) vacuum cleaners that claim to never lose suction and have the ability to get every inch of your carpet clean, but...
new lightdysonlastyears
https://www.eia.gov/electricity/state/NewMexico/index.php
Energy Information Administration - EIA - Official Energy Statistics from the U.S. Government
new mexicoenergy informationelectricityprofileu
https://www.theolivepress.es/spain-news/2021/09/06/spain-looking-at-new-ideas-to-reduce-sky-high-electricity-prices/
SPAIN'S government is looking at fresh moves to reduce sky-rocketing electricity prices. It's expected to announce targeted help for vulnerable customers
new ideassky highspainlookingreduce
https://www.voanews.com/a/new-turbines-boost-ivory-coast-electricity-production/3197729.html
The country has neared its goal of reaching 2000 megawatts in production capacity by 2016
ivory coastelectricity productionnewturbinesboost
https://www.nhpr.org/2019-01-31/deep-freeze-puts-strain-on-midwest-gas-and-electricity-grids
Millions of residents are being asked to turn their thermostats down to ensure there's enough gas for everyone. GM and Ford have suspended some operations in...
deep freezeputsstrainmidwestgas
https://www.politico.eu/article/brussels-demands-new-powers-to-expand-europes-electricity-networks/
Dec 10, 2025 - The EU’s grids urgently need to be renewed and expanded to meet soaring energy demand, Commission argues.
brusselsdemandsnewpowersexpand
https://therealdeal.com/la/2022/04/18/pol-says-power-shortage-threatens-inland-empires-industrial-development/
The Inland Empire, a national powerhouse for distribution warehouses, lacks the electricity to plug in more than a dozen new developments planned for Riverside...
inland empirelackselectricitynewwarehouses
https://www.thecooldown.com/green-home/high-electric-bill-new-house-reddit/
One Redditor was shocked by the nearly $700 energy bill they received for a single month in their new, bigger house.
new homeownerelectricity costssearchessolutionsunexpected
https://www.aoshearman.com/en/insights/financing-the-gap-a-blueprint-for-decarbonization/electricity-markets-must-be-redesigned-for-our-new-reality
Wholesale electricity markets need redesigning for today's diverse energy landscape. Sustainable solutions are required to lower energy prices long-term.
electricity marketsnew realitymustredesigned
https://www.independent.ie/irish-news/government-to-introduce-new-rules-to-limit-data-centres-electricity-use/a610902932.html
The Government is to ­introduce rules to prevent giant data ­centres from using a disproportionate amount of electricity.
new rulesgovernmentintroducelimitdata
https://www.sundaytimes.lk/251005/business-times/ai-new-electricity-for-powering-digital-economy-613911.html
ai newdigital economyprint editionelectricitypowering
https://futurism.com/renewable-have-taken-over-as-the-dominant-source-of-new-electricity-generation
A new report marks 2015 a milestone in clean energy generation. With growth of 153 GW, humans have generated more than half of our net annual additions. This...
renewabletakendominantsource
https://www.sciencenews.org/article/static-electricity-charge-triboelectric
The charge transferred when identical objects touch depends on their history, scientists find.
new physicsstatic electricitysquishymaterialsreveal
https://www.fujitsu.com/nz/about/resources/news/press-releases/2001/20010604-01.html
Fujitsu Australia is delivering fibre optic transmission systems and access equipment that will increase the performance and capacity of the signal network...
electricity networkfujitsupowersupgradensw
https://www.deccanchronicle.com/southern-states/telangana/fixed-charges-for-new-electricity-connections-from-thursday-1934919
TGERC issues new guidelines, replaces distance-based pole and line charges with slab-wise fixed fees
new electricity connectionsfixed chargestelanganathursday
https://www.eia.gov/todayinenergy/detail.php?id=62944
Energy Information Administration - EIA - Official Energy Statistics from the U.S. Government
natural gaselectricity generationheat wavesfiredincreased
https://decrypt.co/51243/bitcoin-miners-in-venezuela-await-new-fair-pricing-for-electricity
In a country with nearly free electricity, how attractive will the new rates be?
bitcoin minersfair pricingvenezuelaawaitnew
https://www.businesstimes.com.sg/companies-markets/energy-commodities/green-electricity-provider-create-1000-new-jobs-uk
[LONDON] A UK clean energy company is seeking to create 1,000 jobs by the end of next year, expanding its technology to simplify the way consumers buy...
green electricitynew jobsprovidercreate
https://egyptindependent.com/electricity-shortage-threatens-operation-of-new-hotels-in-marsa-alam/
The Marsa Alam Investors Association in the Red Sea governorate called for an urgent intervention from relevant authorities to support the region's electrical...
electricity shortagenew hotelsmarsa alamthreatensoperation
https://www.purdue.edu/newsroom/archive/releases/2019/Q3/new-research-aims-to-optimize-farmland-use-for-crops,-solar-electricity-production.html
Purdue University professors are questioning what else fertile farmland can be used for with a new multidisciplinary project researching how to improve future...
new researchaimsoptimizefarmlanduse
https://www.samaa.tv/2087317124-electricity-tariff-slabs-update-protected-non-protected-consumers-monthly-bills
If protected consumer exceeds 200 units limit in month, they will be moved to non-protected category
electricity billscalculatorpernewtariff
https://www.newswire.ca/news-releases/new-study-counters-misinformation-about-the-role-of-renewable-energy-in-electricity-costs-513922561.html
/CNW/ - Environmental Defence released a study today with new data that shows the relatively small role that renewable energy plays in Ontario residential...
new studyrenewable energycountersmisinformationrole
https://www.nhpr.org/2023-08-08/a-tiny-bit-of-electricity-can-help-some-people-with-a-traumatic-brain-injury
Research shows that a tiny pulse of electricity can improve memory in people who've had a moderate or severe traumatic brain injury.
tinybitelectricityhelppeople
https://www.bgr.com/science/new-glow-in-the-dark-wood-doesnt-need-electricity-to-illuminate-homes/
Your next home could have glow-in-the-dark wood pieces to help guide you to bed instead of lights. Here's how.
new glowdark woodneedelectricity
https://www.atlascopco.com/en-nz/compressors/variable-speed-compressors/reduced-air-compressor-electricity-consumption
If you want to reduce electricity consumption, investing in a new variable speed drive (VSD) air compressor may be worthwhile.
air compressorelectricity consumptionatlas copconew zealandachieve
https://www.connexionfrance.com/news/timing-of-off-peak-hours-for-electricity-in-france-is-changing-this-year/705876
Discover how the updated peak/off-peak electricity rates in France will offer more daytime off-peak hours and seasonal variations, benefiting up to 15 million...
electricity ratesnewpeakfrancedaytime
https://reforms-investments.ec.europa.eu/projects/new-capacities-electricity-generation-renewable-sources-tipografia-everest-2001-srl_en
Through the implementation of the project, it was aimed to reduce carbon emissions in the atmosphere by 226.07 tons of CO2/year, thus contributing to the...
electricity generationrenewable sourcescapacitiestipografiaeverest
https://www.notebookcheck.net/Drug-free-skin-infection-control-How-this-new-patch-uses-electricity-instead-of-antibiotics-to-fight-bacteria.907423.0.html
A bioelectronic patch uses mild electrical pulses to control Staphylococcus epidermidis by targeting its excitability under acidic skin conditions. The...
skin infectionnew patchdrugfreecontrol
https://cleanpower.org/news/analysis-no-new-clean-power-in-pjm/
Without new clean energy development, ACP estimates that ratepayers across nine PJM states would pay an additional $360 billion over the next ten years. The...
newanalysishouseholdspaythousands
https://www.heraldnet.com/news/new-computer-centers-could-affect-our-electricity-bill/
computer centerselectricity billnewcouldaffect
https://www.mondaq.com/india/oil-gas-electricity/1192862/automated-smart-meters-the-new-gen-system-of-electricity-regulation
We live in a world where everything is almost too easily automated and technologically fuelled. With the advent of our environment becoming more self-operating...
smart metersnew genelectricity regulationautomatedsystem
https://www.jta.org/jewniverse/2015/the-crazy-new-invention-for-using-electricity-on-shabbat
For many observant Jews, not using electricity is one of the most salient aspects of Sabbath observance. But a new invention aims to change that. By changing...
new inventionusing electricitycrazyshabbatjewish
https://www.samaa.tv/2087317280-electricity-bills-to-skyrocket-as-new-tariff-slabs-applied-from-july-1
Pakistan's Power Division has implemented revised electricity tariff slabs following a Rs5.72 increase in basic rates, effective from July 1, 2024. Discover...
electricity billscalculatenewtariffslabs
https://www.theolivepress.es/spain-news/2021/06/04/how-to-save-money-on-your-monthly-electricity-bills-under-spains-new-tariffs-from-june-1/
SPAIN is introducing new voltage tariffs from June 1 that will significantly affect households and could reduce your monthly bill. You may have noticed
save moneyelectricity billsmonthly
https://www.yahoo.com/news/dodge-muscle-cars-live-versions-160039997.html
Mar 5, 2024 - America’s muscle car culture is adapting to the new world of electric vehicles, but the gasoline-powered high-performance road beasts will be around for at...
dodge musclecarslivenewversions
https://www.utilitydive.com/news/new-york-energy-policies-will-raise-electricity-costs-and-air-pollution-sl/619748/
Sometimes well-intentioned state policies can backfire and hurt the very people the state wants to protect, the author writes.
new yorkenergy policieselectricity costsraiseair