Robuta

https://www.newyorkredbulls.com/2/news/match-recap-new-york-red-bulls-ii-defeat-philadelphia-union-ii-2-1-to-earn-2025-mls-next-pro-playoffs-eastern-conference-title
Nov 4, 2025 - The latest news, scores, highlights and stats from the New York Red Bulls II.
new yorkred bullsphiladelphia unionmatchrecap
https://www.nbcsports.com/watch/podcasts/chris-simms-unbuttoned/divisional-round-preview-giants-vs-eagles
Mike Florio and Chris Simms agree that just because the Giants lost two games to the Eagles in the regular season, it does not mean that New York is destined...
new york giantsphiladelphia eaglesnfldivisionalround
https://6abc.com/new-jersey/
Oct 2, 2024 - Stay updated on the latest news from New Jersey and the surrounding neighborhoods with 6abc. Watch breaking news and live streaming video on 6abc.com.
action newsheadlinesjerseycomphiladelphia
https://whyy.org/articles/how-new-zoning-code-will-impact-northwest-philadelphia/
the newzoning codenorthwest philadelphiaimpactwhyy
https://www.cbsnews.com/philadelphia/video/wawa-to-give-away-free-coffee-at-1000th-store-thursday-in-new-jersey/
Wawa is getting ready to celebrate a major milestone this week.
wawagiveawayfreecoffee
https://www.phila.gov/2021-07-02-six-new-reasons-to-take-a-stroll-down-the-parkway/
As residents and visitors return to Center City, there is something for everyone to enjoy on the Parkway this summer.
reasons tothe parkwaysixnewtake
https://whyy.org/articles/funding-from-tennis-star-gives-philadelphia-charter-school-a-new-home/
A Philadelphia charter school has a new home thanks to an unlikely ally.
charter schoolfundingtennisstargives
https://www.phillymag.com/2014/06/25/watch-tom-corbetts-new-video-everythings-fine-just-fine/
Bonus: Watch Tom Corbett man pose!
tom corbettnew videowatcheverything
https://www.newmindpa.com/tour/
At New Mind Wellness, our mental health programs near Philadelphia create a comfortable and safe space so individuals can find healing.
mental healthphiladelphia panew mindtourprograms
https://unitedforimpact.org/events/summit-2026/
Oct 6, 2025 - Join local and national thought-leaders, changemakers, practitioners, and others committed to creating positive, lasting change. 
united waygreater philadelphiaopportunitysummitsouthern
https://www.post-gazette.com/news/transportation/2021/09/10/amtrak-passenger-service-pittsburgh-harrisburg-philadelphia-new-york-city-the-pennsylvanian/stories/202109100159
Pennsylvania is awaiting a Norfolk Southern study on capital improvements needed between Harrisburg and Pittsburgh before it can move ahead.
pittsburghcouldgetadditionalamtrak
https://www.aaa.com/tripcanvas/hotel/towneplace-suites-by-marriott-new-philadelphia-AA126867
Newly built property offers comfortable rooms complete with kitchens, outdoor grill and a relaxing pool. Just minutes to the very charming Amish Country in...
towneplace suitesnew philadelphiamarriottohio
https://www.sjparty.com/
South Jersey Party Rentals - Event Rentals and Party Rentals in Philadelphia, Cherry Hill NJ, Haddonfield New Jersey, Marlton, Moorestown, Camden, Gloucester...
south jerseynew philadelphiapartyrentals
https://www.nfl.com/videos/zach-wilson-vs-jalen-hurts-which-qb-gets-more-wins-in-21
The "Good Morning Football" crew debates which QB will win more games in 2021: New York Jets QB Zach Wilson or Philadelphia Eagles QB Jalen Hurts.
new york jetszach wilsonphiladelphia eaglesqbvs
https://www.houzz.com/photos/new-home-in-orefield-transitional-kitchen-philadelphia-phvw-vp~126500256
Perimeter Hardware Paint Island - Rift White Oak Wood Driftwood Dark Stain
new hometransitionalkitchenphiladelphialaslo
https://www.trip.com/events/new-york-knicks-at-philadelphia-76ers-20251022/
Searching for information and tickets regarding New York Knicks at Philadelphia 76ers | Philadelphia taking place in Philadelphia on Jan 24, 2026 (UTC-5)?...
new york knicksphiladelphiaticketsdatesitineraries
https://www.visitphilly.com/things-to-do/events/philadelphia-international-flower-show/
Apr 9, 2025 - The nation’s longest-running horticultural event returns for 2025 with a new theme: Gardens of Tomorrow. Here's what to expect.
philadelphia flower shownewmarch
https://www.smsstudios.com/?start=28
South Jersey based Web Site Design and Digital Marketing Company, SEO, SEM, Email Programs, and Web Hosting
web developmentnew jerseyphiladelphia areanjsite
https://bleedingcool.com/comics/recent-updates/things-to-do-in-new-york-and-philadelphia-this-week-if-you-like-comics-4/
Tuesday, February 11th The NY Comics & Picture-story Symposium will be meeting at 7:00 PM at Parsons The New School, Kellen auditorium, 66 Fifth
in new yorkto dothis weekthingsphiladelphia
https://www.philadelphiabasementsystems.com/sump-pump/system.html
Basement Systems has a full line of sump pump systems available to homeowners in Pennsylvania, New Jersey, and Delaware. Sump pump system installation in PA,...
sump pumpsystemsphiladelphianewarkreading
https://www.fox5ny.com/video/1586595
A Medevac plane carrying six people, including a child receiving life-saving treatment, crashed into a residential neighborhood in Philadelphia seconds after...
plane crashesdead foxmedevacphiladelphianew
https://www.mccleerylawfirm.com/
McCleery Law Firm serves New Philadelphia, Columbus, and surrounding areas with legal services in family law, criminal defense, and more.
new philadelphialaw firmohcolumbusmccleery
https://www.hessertchevy.com/
Find great deals on new & used Chevy vehicles at Hessert Chevrolet in Philadelphia, PA. Top service & financing options available!
used carsfor salephiladelphia panewchevrolet
https://prestigedoorohio.com/new-philadelphia-garage-door-repair/
Get Same-Day Garage Door Repairs in New Philadelphia, Ohio with Prestige Door. Best prices on new Garage Doors, Openers, Springs, and more!
garage doornew philadelphiarepairohioprestige
https://mrprealty.com/
MRP Realty is a leading real estate development, acquisition, and construction management firm in Washington DC, Philadelphia, New York, Southeast & Florida.
real estate developmenthome pageconstruction managementfirm
https://www.trumpetintheland.com/
Trumpet in the Land , Ohio's official state play and longest running outdoor theatre production, brings to life the tragic but inspiring story of David...
outdoor dramain thenew philadelphiatrumpetland
https://www.chop.edu/vaccine-update-healthcare-professionals/newsletter/vaccine-resources-lots-new-and-updated-resources
Check out the list of resources from the CDC and AAP, including interim recommendations for use of nirsevimab during the current shortage and updated Red Book...
vaccineresourceslotsnewupdated
https://www.pacificoford.com/ford-edge.htm
Come to Pacifico Ford to shop the brand new Edge, the incredibly unique, extremely capable crossover that delivers on both style and performance.
ford edgephiladelphia panewnear
https://www.inquirer.com/soccer/philadelphia-union-major-league-soccer-statistics-20220320.html
Curtin did not hide his satisfaction over his team delivering a convincing win while having just 27% of the ball possession in the game.
philadelphia uniondon tshow itcarepossession
https://pr.rswliving.com/article/Fulginiti-Law-A-New-Philadelphia-Law-Firm-Secures-First-Big-Client-Win?storyId=66a8fd45709b0518e4dd9595
a newlawphiladelphiafirmfirst
https://www.ecycle1st.org/
Ecycle1st Technology Recycling, LLC is dedicated to helping reduce technology waste through extensive recycling services. We care about the environment!
new jerseynear merecyclingphiladelphiacomputer
https://www.cbsnews.com/philadelphia/news/philadelphia-hearing-aid-ive-better-foundation/
Dec 12, 2025 - A community event in Germantown gave away free hearing aids, letting attendees reconnect with the world through sound.
brand newhearing aidsfor freephiladelphiaevent
https://feverup.com/m/503297
Ring in the New Year with zero boring moments and all-the-fun vibes at Dave & Buster’s! Get your tickets now!
new years evedaveampbusterphiladelphia
https://www.asme.org/conferences-events/events/asme-philadelphia-section-study-of-new-materials-for-next-generation-metal-sulfur-batteries
new materialsnext generationasmephiladelphiasection
https://dirtbikesports.com/
Are you looking for the top 5 dirt bikes near me in Los Angeles, New York, California, or Philadelphia? Discover the ultimate off-road adventure with premier...
dirt bikesnear melos angelestopnew
https://www.cbsnews.com/philadelphia/news/new-technology-improving-prostate-cancer-survival-rates-with-earlier-detection/
In testing involving 129 men, the Smart Target software helped successfully diagnose more than 90 percent of prostate cancers.
cancer survival ratesnewtechnologyimprovingprostate
https://www.phillymag.com/news/2017/11/17/hate-crimes-hotline-philly/
Philly just got a brand new hate crimes hotline as part of the District Attorney Office's Hate Crimes Task Force. Here's the number.
brand new hatephiladelphiagotcrimeshotline
https://www.phillymag.com/foobooz/2012/10/11/new-fall-menu-at-avalon-pasta-bistro/
The leaves are beginning to change colors in Downingtown and Avalon Pasta Bistro is readying the fall flavors. Enticing dishes let some seasonal stars shine in...
philadelphia magazinenewfallmenuavalon
https://www.cbsnews.com/philadelphia/news/police-4-children-1-adult-killed-crash-new-castle-county-townsend-delaware/
Delaware State Police are investigating a multi-fatal crash in New Castle County on Friday afternoon.
new jerseyvehicle crashfatherdaughterskilled
https://www.sagehairohio.com/
Welcome to Sage Hair, your sanctuary for expert hair styling and nail care in the New Philadelphia and Dover area. Our skilled hair stylists and nail techs are...
nail salonnew philadelphiahairdoverohio
https://www.autotrader.com/cars-for-sale/vehicle/753119129?city=Woodbury&listingType=NEW&makeCode=DODGE&modelCode=DODHORNET&state=NJ&clickType=listing
for sale near you in Philadelphia, PA. Get more information and car pricing for this vehicle on Autotrader.
dodge hornetnewblacktop
https://dev.thp.homes/findyournewhome
We are top-rated home builders providing you with a variety of new construction homes in and around Philadelphia. Reserve your lot with a pre-approval letter.
homes for salenewconstructionaroundphiladelphia
https://npmunicipalcourt.org/hours.php
philadelphia municipal courtnew
https://www.cbsnews.com/philadelphia/video/new-jersey-gov-mikie-sherrill-suspends-nj-transit-service-for-snowstorm/
New Jersey Gov. Mikie Sherrill is suspending NJ Transit service during the winter storm on Sunday, when heavy snow is forecast to bury the Tri-State Area.
new jerseymikie sherrillnj transitgovsuspends
https://www.cbsnews.com/philadelphia/news/new-health-site-matches-patients-with-doctors-using-insurance-database/
From billions of insurance records comes the one doctor for you: that's the idea behind a new website that helps you search for a specialist and schedule...
newhealthsitematchespatients
https://www.newyearsevetickets.com/philadelphia
The best NYE Philadelphia New Years Eve 2023 parties & events at the hottest and most popular bars, clubs, lounges, and venues in Philadelphia.
new years evephiladelphiaphillybestnye
https://www.cbsnews.com/philadelphia/video/more-than-100-new-coats-distributed-to-children/
The coats were distributed at the Merakey Philadelphia branch on Lehigh Avenue.
more thancbs philadelphianewcoatsdistributed
https://thepointsguy.com/news/chase-sapphire-lounge-philadelphia-airport/
Chase's amenity-packed new lounge at Philadelphia International Airport is easily the nicest space in the airport and rivals the best airport lounges in the...
insidechasegorgeousnewsapphire
https://www.cbsnews.com/philadelphia/news/sylvester-stallone-teases-a-new-project-while-hanging-out-at-the-rocky-statue/
He did not give any specifics but said we will see it in a few months.
sylvester stallonenew projecthanging outteases
https://www.ubereats.com/store/new-leaf-2-chinese-%26-japanese-cuisine/Q4hknSMeR-SwL2utnZQ7dA?mod=quickView&modctx=%257B%2522storeUuid%2522%253A%25224388649d-231e-47e4-b02f-6bad9d943b74%2522%252C%2522sectionUuid%2522%253A%2522e11df062-c8cb-54dc-b254-d5e274f59755%2522%252C%2522subsectionUuid%2522%253A%25220379a62a-1156-4ddb-a09a-7e1dc45d5dfb%2522%252C%2522itemUuid%2522%253A%2522c263eb1c-d387-54de-bbba-b60b980510be%2522%252C%2522showSeeDetailsCTA%2522%253Atrue%257D&ps=1
Use your Uber account to order delivery from New Leaf 2 Chinese & Japanese Cuisine in Philadelphia. Browse the menu, view popular items, and track your order.
new leafchinese japaneseordercuisinemenu
https://www.cbsnews.com/philadelphia/news/new-jersey-gov-phil-murphy-to-lay-out-2020-agenda-in-speech-before-lawmakers/
Gov. Phil Murphy will lay out his agenda for the year as he delivers his second State of the State address before a joint-session of the Democrat-led...
new jerseyphil murphylay outgovagenda
https://www.visitphilly.com/things-to-do/attractions/christmas-village-in-philadelphia/
Oct 31, 2025 - Philly becomes a European wonderland for the annual Christmas Village, with holiday shopping, German food and carnival rides.
center citychristmas villagephiladelphianew
https://www.newlogical.com/new-logical-sports-expands-operations-to-philadelphia-eastern-long-island-and-key-new-jersey-markets/
eastern long islandnewlogicalsportsexpands
https://bsg-nj.com/thank-you/
We Will Contact You ASAP!
thank younew jerseyblackstonesecuritygroup
https://eventcut.com/
Build community engagement. Feature your brand evangelists at their best during your event. A testimonial video you could never arrange. Experience. Captured.
new yorkeventvideoproductionsphiladelphia
https://www.allaboutthejersey.com/devils-games/63377/2025-26-gamethread-21-new-jersey-devils-at-philadelphia-flyers
Nov 22, 2025 - Come on Devils! A rivalry win for the New Jersey Devils over the Philadelphia Flyers would do wonders for morale right now.
new jersey devilsphiladelphia flyers
https://unitedforimpact.org/growing-the-movement/companies/
Jul 10, 2025
southern new jerseyunited waygreater philadelphiacompanies
https://www.phillymag.com/news/2018/07/10/philadelphia-board-education-meeting/
The Philadelphia Board of Education held its first ever public meeting on Monday. Members elected former School Reform Commission chair Joyce Wilkerson as...
board of educationthe newphiladelphiaholdsfirst
https://capitalanalyticsassociates.com/invest-philadelphia-fifth-anniversary-edition-to-highlight-transformative-projects-new-leadership/
Jun 20, 2025 - The region’s strategies to ensure success will be the focal point of the official Invest: Philadelphia 2023-2024 Launch Conference.
anniversary editioninvestphiladelphiafifthhighlight
https://www.familybuildinglaw.net/adoption-services
At the Law Offices of Deborah E. Spivack, we are committed to providing exceptional legal services tailored to meet the unique needs of our clients.
new jerseyphiladelphia paadoptionservicesdelaware
https://elitehomeremodeling.net/new-kitchen-in-south-philadelphia-home/
Elite Home Remodeling installed this new kitchen in South Philadelphia. The project took an existing 10x10 kitchen with builder's grade cabinets
south philadelphianewkitcheneliteremodeling
https://www.cbsnews.com/philadelphia/video/camden-new-jersey-nonprofit-that-cares-for-vulnerable-kids-hit-by-rising-costs/
Saving Grace Ministries, a nonprofit on Market Street in Camden, New Jersey, is one of many nonprofits struggling to achieve their goals due to rising costs....
camden new jerseynonprofitcaresvulnerablekids
https://www.phillymag.com/property/2017/10/24/trinity-tuesday-a-new-twist-in-bella-vista-for-285k/
In contrast to most homes of this type, this trinity has a spiral staircase you just might be able to get your mattress up without a fight.
a newbella vistatrinitytuesdaytwist
https://www.pacificomarplelincoln.com/carfinder/index.htm
Use our online CarFinder tool to help you find the specific vehicle you're looking for in greater Philadelphia!
philadelphia patoolfindnewused
https://unitedforimpact.org/contact-us/
Nov 6, 2024
contact usunited waygreater philadelphiasouthernnew
https://www.nordstrom.com/s/mens-new-era-cream-philadelphia-76ers-piped-pop-panel-59fifty-fitted-hat/7616036
new eramen screamphiladelphiapiped
https://www.naturalnews.com/2024-06-13-eight-illegal-aliens-terrorists-arrested-isis.html
Ever since 9/11, the United States government via the Patriot Act has been illegally spying on Americans under the guise of fighting terrorism. Why, then, do...
illegal aliensto beeightsuspectedterrorists
https://www.phillymag.com/news/2021/02/01/philadelphia-snowplow-app-plowphl/
If you want to know how the snowplowing is going in Philadelphia, you'll soon be able to track city snowplows with the PlowPHL app.
let younewapptrackphiladelphia
https://www.inquirer.com/life/best-places-to-sled-philadelphia-and-beyond-20260124.html
Here's where to go to get the most out of the snowfall.
the bestsleddinghillsphiladelphiasuburbs
https://www.mlb.com/stories/game/776371?ap=1&storylocal=article-embed&canonical=http%3A%2F%2Fwww.mlb.com%2Fstories%3Fs%3Dhttps%253A%252F%252Fwww.mlb.com%252Fstories%252Fgame%252F776371%253Fap%253D1%2526storylocal%253Darticle-embed
new york metsphiladelphia philliesgame storyscoreshighlights
https://phillyfieldhockey.sportngin.com/register/form/747940895
field hockeywelcomenewplayerboard
https://vipnightlife.com/events/philadelphia-under-the-fireworks-yacht-party-new-years-eve-2026
Cruise into the New Year on one of Philly's best party yachts, Ben Franklin Yacht in Philadelphia. Under the Fireworks New Years Eve 2026.
yacht partynew yearphiladelphiafireworks
https://www.phillymag.com/2016/09/10/fall-weekend-getaway-firelight-camps-ithaca-new-york/
Break out of your comfort zone at this decidedly cosmopolitan campground.
weekend getawaynew yorkfirelightcampsglamping
https://www.livebroadandnoble.com/
Introducing Broad + Noble, a new luxury apartment tower debuting in the vibrant Center City district of Philadelphia.
center city philadelphialuxury apartmentsbroadnoblenew
https://www.phillymag.com/foobooz/2012/12/27/honeygrow-rolls-out-new-dishes-for-winter/
Honeygrow has debuted three new stir fries for winter. Each dish offers a new combination of noodles, protein, fresh vegetables and warming spices.5 Spice...
philadelphia magazinerollsnewdisheswinter
https://www.cbsnews.com/philadelphia/news/booker-pollution-bill/
Senator Booker and Congressman Raul Ruiz of California have introduced the Environmental Justice Bill.
to protectlow incomeenvironmentalbillaims
https://www.phillymag.com/tag/new-ideas/page/2/
new ideasphiladelphia magazinearchives
https://www.cbsnews.com/philadelphia/video/mtv-music-video-awards-happening-sunday-in-new-jersey/
Nicki Minaj, Jack Harlow and LL Cool J are hosting the event.
music video awardsnew jerseymtvhappeningsunday
https://www.metmuseum.org/art/collection/search/676456
Inscription: Printed text on recto of card: Murphy, r.f. Phila. Amer.Printed text on verso of card: This card is one/ of a set of/ 50 Base Ball Players/...
new yorkdaniel murphyniagarabakingcompany
https://www.gabrielbuildinggroup.com/maintenance-request
building groupnew jerseygabrielmaintenancerequest
https://www.newyorkredbulls.com/2/news/photos-of-the-match-new-york-red-bulls-ii-vs-philadelphia-union-ii
Nov 2, 2025 - The latest news, scores, highlights and stats from the New York Red Bulls II.
the matchnew yorkred bullsphotosii
https://www.cbsnews.com/philadelphia/news/gym-blind-boy-glasses/
Dec 19, 2017 - A legally blind boy is getting the gift of sight this Christmas thanks to a New Jersey gym.
new jerseylegally blindgymgivesgift
https://whyy.org/articles/philadelphia-detours-see-city-again-new-perspective/
a new perspectivethe cityphiladelphiadetourssee
https://www.cbsnews.com/philadelphia/news/new-jersey-dioceses-extend-deadline-for-victims-fund/
New Jersey's Roman Catholic dioceses have given a six-week extension to childhood victims of sexual assault considering applying for compensation from a fund...
new jerseycbs philadelphiadiocesesextenddeadline
https://www.ford.com/local/philadelphia-harrisburg-allentown/
Shop at Your Philadelphia, Harrisburg and Allentown Local Ford Dealers. View current cash incentives, APR financing and lease offers for a new car, truck, suv...
a newbuyfordphiladelphiaharrisburg
https://www.active.com/philadelphia-pa/technology/camp/greek-mythology-camp-new-2026
For event details, please refer to: https://www.active.com/philadelphia-pa/technology/camp/greek-mythology-camp-new-2026
greek mythologynew philadelphiacamppa
https://www.eyetoeyevc.co/
At Eye to Eye Visioncare, we assist with all of the Optometry needs of the New Philadelphia community. Call 3303398788 to schedule an appointment in New...
new philadelphiaoptometryeye
https://www.allaboutthejersey.com/devils-game-recaps/63385/first-period-meltdown-dooms-new-jersey-devils-in-6-3-loss-to-philadelphia-flyers
Nov 23, 2025 - Tonight’s game was decided by one of most rapid downfalls you will ever see.
new jersey devilsfirst periodmeltdowndooms
https://www.inquirer.com/education/philadelphia-school-facilities-buildings-closing-strategic-plan-20240918.html
Some schools are bursting at the seams and others are underenrolled. School closures are possible, but so are co-locations, new construction, and creative uses...
new buildingsphiladelphiaschoolclosurescould
https://www.foxsports.com/mlb/philadelphia-phillies-vs-new-york-yankees-aug-03-2020-game-boxscore-78332?tab=boxscore
View the box score for the Philadelphia Phillies vs. New York Yankees game played on August 03, 2020 including team and player statistics and results.
new york yankeesphiladelphia philliesbox scorevsstats
https://www.bochettoandlentz.com/
Bochetto & Lentz, P.C. represents clients with trial attorney services in Philadelphia & NJ. Our trial attorneys in NJ & PA offer legal representation to...
philadelphia panew jerseytrialattorneyslawyers
https://www.mlb.com/stories/game/777015?ap=1&storylocal=article-embed&canonical=http%3A%2F%2Fwww.mlb.com%2Fstories%3Fs%3Dhttps%253A%252F%252Fwww.mlb.com%252Fstories%252Fgame%252F777015%253Fap%253D1%2526storylocal%253Darticle-embed
new york yankeesphiladelphia philliesgame storyscoreshighlights
https://www.phillymag.com/2009/05/15/new-product-zwack/
Similar in flavor to Jagermeister but with a slightly more citrusy edge, Zwack has been drunkifying Hungarians since the late 1700s. It just became available...
new productphiladelphia magazinezwack
https://www.chop.edu/news/warm-welcome-our-new-staff
Our Division of Nephrology continues to grow, with several new team members. See below to meet our new fellows and advanced practice providers.
a warm welcomenewstaffchildrenhospital
https://www.phillyvoice.com/new-survey-reveals-best-hospitals-philadelphia-region/
Which hospitals in the Philadelphia area are the best at providing health care? A national report released recently has the answer.
philadelphia regionnewsurveyrevealsbest
https://www.va.gov/northeast-ohio-health-care/locations/new-philadelphia-va-clinic/
Get address and hours, parking and transportation information, and health services offered at New Philadelphia VA Clinic
new philadelphiava clinicnortheast ohiohealth careveterans
https://www.jqstaffingservices.com/new-page.html
Administration Assistant/Office Assistant/Data Entry Event Staff - Greeters, Banquet Servers, Bartenders Electronic Assemblers Housekeeping/Facility...
new pageemployment agencyjqstaffingservices
https://bleedingcool.com/comics/recent-updates/things-to-do-in-new-york-and-philadelphia-this-week-if-you-like-comics-9/
Monday, August 11th The ninety-fourth meeting of the NY Comics & Picture-story Symposium will be held on Monday, August 11, 2014 at 7 pm at Columbia
in new yorkto dothis weekthingsphiladelphia
https://www.gap.com/browse/new/nba-collection/philadelphia-76ers?cid=3043838&style=3044367
Shop Gap for the New NBA Collection Philadelphia 76ers you need. Our iconic pieces. Your personal style. Since 1969.
newnbacollectionphiladelphiagap
https://www.chop.edu/news/new-treatment-shows-success-high-risk-solid-tumors
The CHOP-engineered therapy overcomes common drug resistance and has potential to elicit fewer toxicities than most cancer treatments.
high risksolid tumorsnewtreatmentshows