Robuta

https://www.freecad.org/ FreeCAD: Your own 3D parametric modeler FreeCAD, the open source 3D parametric modeler your ownfreecadparametricmodeler https://www.fil.ion.ucl.ac.uk/spm/ SPM - Statistical Parametric Mapping Statistical Parametric Mapping refers to the construction and assessment of spatially extended statistical processes used to test hypotheses about functional... spmstatisticalparametricmapping https://descartesunderwriting.com/ Parametric Insurance for Climate, Cyber & Emerging Risks Protect your business with Descartes Underwriting's parametric insurance solutions, offering swift, data-driven coverage for climate, cyber and other emerging... parametric insurancefor climatecyberemergingrisks https://parametric.ch/ Parametric GmbH – Rail & Transport Infrastructure Intelligence | Rail intelligence and IoT sensor... Rail intelligence and IoT sensor solutions for wheel-rail interaction, condition monitoring, and connectivity across rail and transport infrastructure. rail transportinfrastructure intelligenceparametricgmbhiot https://parametric-architecture.com/ Parametric Architecture - Architecture News & Computational Design Jul 6, 2026 - Hear from us first about famous architectural projects and technological innovations combined with architecture. parametric architecturenewscomputationaldesign https://campedersen.com/vcad Parametric CAD in Rust - Cam Pedersen I keep designing physical parts for our robots. Motor mounts, sensor brackets, wheel hubs. Every time, the workflow is the same: open a GUI CAD program, click a parametriccadrustcampedersen https://www.boruidi.com/ China Outdoor Furniture Manufacturers, Parametric Furniture Suppliers, Sculpture Factory | Huizhou... Huizhou Boruidi Industrial Co., Ltd.: We are one of the leading manufacturers and suppliers of outdoor furniture, parametric furniture, sculpture, fiberglass... china outdoorfurniture manufacturersparametricsupplierssculpture https://ptc-solutions.de/ Creo Parametric, Windchill, Mathcad - PTC Software & Schulung Apr 20, 2026 - Creo Parametric ✔ Windchill ✔ Mathcad ✔ Bestellen Sie Ihre PTC Software, Schulung, Support und Dienstleistung vom authorisierten Partner ➔ PTC Solutions creo parametricptc softwarewindchillmathcadschulung https://solvespace.com/index.pl SolveSpace - parametric 3d CAD solvespaceparametriccad https://www.expressmarine3d.com/ Parametric Ship Modelling | Express Marine AS ExpressMarine - parametric marine structures modeling plug-in for Rhinoceros3D ship modellingparametricexpressmarine https://www.analog.com/en/parametricsearch/2453 Selection Table for Battery Monitors & Fuel Gauges | Parametric Search | Analog Devices selection tablebattery monitorsfuel gaugesparametric search https://iss2022.acm.org/details/iss-2022-posters/8/Spatialphonic360-Accuracy-of-the-Arbitrary-Sound-Image-Presentation-using-Surroundin Spatialphonic360: Accuracy of the Arbitrary Sound Image Presentation using Surrounding Parametric... Welcome! ACM ISS 2022 is now over, thank you for coming, we hope you had a great experience. See you next year at ACM ISS 2023 in Pittsburgh, PA, USA! Welcome... of theimage presentationaccuracyarbitrary https://www.microchip.com/en-us/parametric-search/4017 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://www.hindustantimes.com/india-news/ndma-ramping-up-heat-action-plans-eyes-parametric-insurance-to-shield-vulnerable-workers-101776826081551.html NDMA ramping up Heat Action Plans, eyes parametric insurance to shield vulnerable workers | India... Apr 22, 2026 - NDMA ramping up Heat Action Plans, eyes parametric insurance to shield vulnerable workers | India News https://emodnet.ec.europa.eu/geonetwork/srv/api/records/9db8a21a-b17b-4b25-82dd-104adfc00190 Parametric subbottom profiles (17 to 21) in the Ceuta canyon region. Parametric subbottom profiles in order to define the main geohazard features in the Ceuta canyon region. in theparametricprofiles https://researchportalplus.anu.edu.au/en/publications/optomechanical-design-and-construction-of-a-vacuum-compatible-opt/fingerprints/ Optomechanical design and construction of a vacuum-compatible optical parametric oscillator for... design and construction https://discovery.fiu.edu/display/pub59955 Benefits of using 0.7 in. (18 mm) diameter strands in precast, pretensioned girders: A parametric... https://www.morganstanley.com/im/en-be/institutional-investor/insights/articles/diversification-beyond-traditional-indexes.html Commodities: Diversification Beyond Traditional Indexes | Parametric Portfolio Associates | Morgan... Discover how seeking out a well-diversified commodity portfolio, rather than defaulting to a headline index, may offer better performance for investors. commoditiesdiversificationbeyondtraditionalindexes https://muidsi.missouri.edu/modeling-pyrus-calleryana-spread-in-central-missouri-using-remote-sensing-and-a-non-parametric-modeling-approach/ Modeling Pyrus calleryana spread in central Missouri using remote sensing and a non-parametric... Invasive species pose a unique threat to native species and habitat through direct and indirect competition of resources. Management of invasive species... https://openresearch.surrey.ac.uk/esploro/outputs/journalArticle/Multi-parametric-imaging-of-murine-brain-using/99783189802346 Multi-parametric imaging of murine brain using spectral and time domain optical coherence... Oct 1, 2012 - Examination of brain functions in small animal models may help improve the diagnosis and treatment of neurological conditions. Transcranial imaging of small... https://www.morganstanley.com/im/en-cl/institutional-investor/strategies/parametric-multifactor.html Parametric Multifactor Strategies | Morgan Stanley Parametric Multifactor Strategies seek to provide a performance boost beyond equal-weighting of factors by monitoring and re-allocating exposure across target... parametricmultifactorstrategiesmorganstanley https://nrc-publications.canada.ca/eng/view/object/?id=d1831c4f-cbe1-46c1-bc1a-68d484e6fff8 Preliminary parametric study of a tidal energy device using an open-source CFD tool - NRC... Preliminary parametric study of a tidal energy device using an open-source CFD tool https://www.microchip.com/en-us/parametric-search/443 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://www.microchip.com/en-us/parametric-search/413 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://repository.lib.ncsu.edu/items/1aad20b8-9956-4ced-b202-f86a55c1e7f7 Non-parametric ANOVA in small samples : a Monte Carlo study of the adequacy of the asymptotic... https://ucrisportal.univie.ac.at/en/publications/quantum-state-preparation-of-ferromagnetic-magnons-by-parametric-/ Quantum State Preparation of Ferromagnetic Magnons by Parametric Driving - University of Vienna quantumstatepreparation https://research.utwente.nl/en/publications/fibre-pumped-optical-parametric-oscillators-flexible-sources-for-/ Fibre-pumped optical parametric oscillators - flexible sources for applications in mid-IR molecular... https://publica.fraunhofer.de/entities/publication/38951b47-1f2b-4ea0-937d-238d98f6f804 All-optical level equalization of data packets using a fiber-optic parametric amplifier An ultrafast bit rate and format transparent all-optical packet equalizer is presented, based on fiber-optic parametric amplification. Its equalizing... https://experts.arizona.edu/en/publications/high-power-widely-tunable-synchronously-pumped-fiber-based-optica/ High power, widely tunable synchronously pumped fiber-based optical parametric oscillator -... high powerwidelytunable https://www.ornl.gov/publication/description-and-use-scale-sampler-parametric-capability-engineering-analysis-and Description and Use of SCALE Sampler Parametric Capability for Engineering Analysis and... for engineeringdescriptionusescale https://www.microchip.com/en-us/parametric-search/929 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://collaborate.princeton.edu/en/publications/non-parametric-few-shot-learning-for-word-sense-disambiguation/fingerprints/ Non-Parametric Few-Shot Learning for Word Sense Disambiguation - Fingerprint - Princeton University learning for https://www.microchip.com/en-us/parametric-search/1265 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://www.morganstanley.com/im/en-au/institutional-investor/about-us/investment-teams/solutions-and-multi-asset/parametric-team.html Parametric Team Parametric is a global asset manager that's spent 35 years designing and delivering customized solutions for our clients. We use a systematic, rules-based... parametricteam https://econpapers.repec.org/article/eeeinteco/v_3a178_3ay_3a2024_3ai_3ac_3as2110701724000295.htm EconPapers: A decade of Eurasian integration: An ex-post non-parametric assessment of the Eurasian... By Augusto Cerqua, Pierluigi Montalbano and Zhansaya Temerbulatova; Abstract: This paper provides a sound ex-post evaluation of the impact of the Eurasian... https://research.tue.nl/en/publications/efficient-sensitivity-analysis-for-parametric-robust-markov-chain/ Efficient Sensitivity Analysis for Parametric Robust Markov Chains - Research portal Eindhoven... sensitivity analysismarkov chainsresearch portalefficientparametric https://www.mathworks.com/help/audio/ref/multibandparametriceq-system-object.html multibandParametricEQ - Multiband parametric equalizer - MATLAB The multibandParametricEQ System object performs multiband parametric equalization independently across each channel of input using specified center... multibandparametricequalizermatlab https://liu.diva-portal.org/smash/record.jsf?pid=diva2:264454 Integration of Parametric CAD and Dynamic Models for Industrial Robot Design and Optimization dynamic models https://gking.harvard.edu/publication/matching-as-nonparametric-preprocessing-for-reducing-model-dependence-in-parametric-causal-inference/ Matching As Nonparametric Preprocessing for Reducing Model Dependence in Parametric Causal... Jan 1, 2007 - Although published works rarely include causal estimates from more than a few model specifications, authors usually choose the presented estimates from... matchingpreprocessing https://www.microchip.com/en-us/parametric-search/727 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://andysbrainblog.blogspot.com/2014/08/parametric-modulation-with-spm-why.html Andy's Brain Blog: Parametric Modulation with SPM: Why Order Matters Those who are the youngest children in the family are keenly aware of the disadvantages of being last in the pecking order; the quality of ... andy sbrain blogparametric https://arxiv.org/abs/physics/0503231 [physics/0503231] Statistical modelling of tropical cyclone tracks: a semi-parametric model for the... Abstract page for arXiv paper physics/0503231: Statistical modelling of tropical cyclone tracks: a semi-parametric model for the mean trajectory https://forums.unrealengine.com/t/kurmanin-tailor-leather-bomber-outfit-parametric-clothing/2717340 Kurmanin Tailor - Leather Bomber Outfit- PARAMETRIC CLOTHING - Product Discussion - Epic Developer... Apr 23, 2026 - Heading out for an investigation? Love long weekend walks in the park? Planning a heist? No matter who you are or what your mission is- this set fits every... product discussiontailorleatherbomberoutfit https://asklibrarykzbz.netlify.app/what-is-parametric-equation-of-circle-in-3d-876.html What is parametric equation of circle in 3d Sep 24, 2014 Since a circle is an ellipse where both foci are in the center and both axes are the same length, the parametric form of a circle is... what isparametricequationcircle https://www.morganstanley.com/im/en-be/institutional-investor/insights/press-release/parametric-announces-new-additions-to-its-custom-active-partner-network-expands-ovreall-offering-with-16-strategies.html Parametric Adds Strategies to Custom Active | Morgan Stanley | Morgan Stanley parametricaddsstrategiescustomactive https://research.tudelft.nl/en/publications/heat-in-courtyards-a-validated-and-calibrated-parametric-study-of/ Heat in courtyards: A validated and calibrated parametric study of heat mitigation strategies for... https://ideas.repec.org/a/eee/appene/v87y2010i4p1349-1357.html Parametric study and optimization of a transcritical power cycle using a low temperature source Downloadable (with restrictions)! A parametric study and optimization is performed on a transcritical power cycle using six performance indicators: thermal... https://vtechworks.lib.vt.edu/items/e4dd78aa-8dc7-4032-afdf-603715443f6f/full Approximation of Parametric Dynamical Systems Dynamical systems are widely used to model physical phenomena and, in many cases, these physical phenomena are parameter dependent. In this thesis we... approximationparametricsystems https://meetings-archive.aps.org/mar/2012/b4/7/ Mechanical squeezing via parametric amplification and feedback control - Instrumentation of... We discuss the mechanical squeezing that can result from position measurement and feedback applied to a parametrically driven mechanical oscillator. If the para feedback controlmechanicalsqueezingviaparametric https://de.mathworks.com/matlabcentral/fileexchange/171264-parametric-3d-bowl-maker Parametric 3D Bowl Maker - File Exchange - MATLAB Central Download and share free MATLAB code, including functions, models, apps, support packages and toolboxes file exchangeparametricbowlmakermatlab https://www.nist.gov/publications/comparison-confidence-intervals-large-operational-biometric-data-parametric-and-non-0 Comparison of confidence intervals for large operational biometric data by parametric and... confidence intervals https://liu.diva-portal.org/smash/record.jsf?pid=diva2:264453 Exploring Parametric CAD-models in Aircraft Conceptual Design cad modelsexploringparametricaircraftconceptual https://www.mediafire.com/file/7fx3l4xb76aihxv/Practice+File+-+Wavy+Parametric+Facade.zip/file Practice File - Wavy Parametric Facade MediaFire is a simple to use free service that lets you put all your photos, documents, music, and video in a single place so you can access them anywhere and... practicefilewavyparametricfacade https://eprints.soton.ac.uk/179553/ Detailed characterisation of a fiber-optic parametric amplifier in phase-sensitive and... of afiber optic https://www.wolfram.com/language/12/probability-and-statistics/parametric-distributions-performance-improvements.html.en?footer=lang Parametric Distributions Performance Improvements: New in Wolfram Language 12 performance improvementsnew inwolfram languageparametricdistributions https://pure.psu.edu/en/publications/assessing-boundary-condition-and-parametric-uncertainty-in-numeri/ Assessing boundary condition and parametric uncertainty in numerical-weather-prediction-modeled,... numerical weather predictionassessingboundaryconditionparametric https://www.epc.ed.tum.de/en/rt/research/intelligent-and-nonlinear-control/past-topics/robust-parametric-control/ Robust parametric control - Chair of Automatic Control robustparametriccontrolchairautomatic https://therevitkid.blogspot.com/2009/03/tutorial-parametric-arrays.html?showComment=1253114379060 Tutorial: Parametric Array's | TheRevitKid.com! - Tutorials, Tips, Products, and Information on all... I discovered a neat little formula to use when creating line based generic models. Topics covered: - Creating a Generic Model - Line Based -... https://gpbib.cs.ucl.ac.uk/gp-html/racine_1999_pcGPcs.html Parametric Coding vs Genetic Programming: A Case Study genetic programmingparametriccodingvscase https://scholars.uky.edu/es/publications/parametric-study-of-an-acid-baking-process-for-rare-earth-element/ Parametric study of an acid baking process for rare earth element recovery from a bituminous-coal... https://experts.illinois.edu/en/publications/parametric-effects-on-thin-film-growth-and-uniformity-in-an-atmos/ Parametric effects on thin film growth and uniformity in an atmospheric pressure impinging jet CVD... https://dspace.mit.edu/handle/1721.1/14399?show=full Computation and pre-parametric design computationpreparametricdesign https://drum.lib.umd.edu/items/3cb087bf-facd-42e2-963d-ced79c6c76db/full Parametric AFEM for Geometric Evolution Equations and Coupled Fluid-Membrane Interaction When lipid molecules are immersed in aqueous environment at a proper concentration they spontaneously aggregate into a bilayer or membrane that forms an... parametricafemgeometricevolution https://arxiv.org/abs/1311.2704 [1311.2704] Background field method, Batalin-Vilkovisky formalism and parametric completeness of... Abstract page for arXiv paper 1311.2704: Background field method, Batalin-Vilkovisky formalism and parametric completeness of renormalization https://www.microchip.com/en-us/parametric-search/420 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://www.microchip.com/en-us/parametric-search/589 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://arxiv.org/abs/1704.00796 [1704.00796] A Parametric Interpolation Framework for 1D Scalar Conservation Laws using the Equal... Abstract page for arXiv paper 1704.00796: A Parametric Interpolation Framework for 1D Scalar Conservation Laws using the Equal Area Principle https://www.microchip.com/en-us/parametric-search/1266 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://digital.library.adelaide.edu.au/items/7a586d4c-a01c-4546-b6ca-67bb93ff9b12 A wald-type of quadratic parametric restrictions This paper proposes a Wald-type test for testing a restriction that is a quadratic functional form. The results of our Monte Carlo studies suggest that the... waldtypequadraticparametricrestrictions https://www.innomar.com/innomar-home Innomar parametric sub-bottom profilers INNOMAR provides parametric (non-linear) sub-bottom profilers for shallow and deep waters down to full ocean depth. sub bottomparametricprofilers https://amt.copernicus.org/articles/18/6853/2025/amt-18-6853-2025-assets.html AMT - Assets - An adaptable DTS-based parametric method to probe near-surface vertical temperature... Abstract. We present a novel, fine-resolution temperature profiling method based on Distributed Temperature Sensing (DTS) that is adaptable, reproducible, and... https://www.microchip.com/en-us/parametric-search/1572 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://stars.library.ucf.edu/honorstheses/1/ "A Parametric Study of Meso-Scale Patterns for Auxetic Mechanical Behav" by Matthew C. Schuler This thesis focuses on the development, parameterization and optimization of a novel meso-scale pattern used to induce auxetic behavior, i.e., negative... https://www.microchip.com/en-us/parametric-search/4087 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://cordis.europa.eu/project/id/864202/es Better Languages for Statistics: foundations for non-parametric probabilistic programming | BLaSt |... Probabilistic programming is a powerful method for Bayesian statistical modelling, particularly where the sample space is complex or unbounded... probabilistic programmingbetterlanguagesstatisticsfoundations https://repository.lib.ncsu.edu/items/0673eca3-1cd7-4abd-9028-022d81ad50f4 On a class of non-parametric tests of interactions in factorial experiments non parametric testsclass of https://researchconnect.buffalo.edu/en/publications/initial-investigation-of-the-use-of-angiographic-parametric-imagi/ Initial investigation of the use of angiographic parametric imaging for early prognosis of delayed... of the https://m.wolframalpha.com/input?i=3d+parametric+plot+%28cos+t%2C+sin+2t%2C+sin+3t%29 3d parametric plot (cos t, sin 2t, sin 3t) - Wolfram|Alpha parametricplotcossinwolfram https://www.morganstanley.com/im/en-no/institutional-investor/insights/press-release/msim-adds-latest-strategy-parametric-equity-plus.html MSIM adds Parametric Equity Plus | Morgan Stanley | Morgan Stanley addsparametricequityplusmorgan https://www.microchip.com/en-us/parametric-search/1551 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://www.cg.tuwien.ac.at/research/publications/2018/ohrhallinger_stefan-2018-pg/ StretchDenoise: Parametric Curve Reconstruction with Guarantees by Separating Connectivity from... parametriccurvereconstructionguaranteesseparating https://community.adobe.com/questions-544/hp-filter-in-parametric-eq-adobe-audtion-13-160217 HP Filter in Parametric EQ Adobe Audtion 13 | Community Wondering why if you apply a High Pass Filter (preset or manual) in the parametric EQ does it raise the volume of the frequencies beyond the frequency t... hp filterparametric eqadobeaudtioncommunity https://publikationen.uni-tuebingen.de/xmlui/handle/10900/127916 A parametric texture model based on deep convolutional features closely matches texture appearance... model based https://www.microchip.com/en-us/parametric-search/385 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://experts.arizona.edu/en/datasets/parametric-smoothing-model-for-visco-elastic-polishing-tools/ Parametric smoothing model for visco-elastic polishing tools - University of Arizona polishing toolsuniversity ofparametricsmoothingmodel https://pure.psu.edu/en/publications/parametric-amplification-of-matter-waves-in-periodically-translat/ Parametric amplification of matter waves in periodically translated optical lattices - Penn State of matter https://isprs-archives.copernicus.org/articles/XLVIII-2-W4-2024/405/2024/isprs-archives-XLVIII-2-W4-2024-405-2024.html ISPRS-Archives - CRAFTING AND MODIFYING RHINE CASTLE MODELS WITH PARAMETRIC MODELING IN BLENDER https://pure.psu.edu/en/publications/maximizing-average-power-output-of-an-airborne-wind-energy-genera/ Maximizing average power output of an airborne wind energy generator under parametric uncertainties... https://nuit-blanche.blogspot.com/2009/11/cs-real-vs-complex-null-space.html Nuit Blanche: CS: Real vs. complex null space properties, Non-Parametric Bayesian Dictionary... A blog about Compressive Sensing, Computational Imaging, Machine Learning. Using priors to avoid the curse of dimensionality arising in Big Data. https://www.microchip.com/en-us/parametric-search/316 Parametric Search | Microchip Technology parametric searchmicrochiptechnology https://murray.cds.caltech.edu/index.php?title=Parametric_Delay-margin_Maximization_of_Consensus_Network_Using_Local_Control_Scheme&action=formedit Edit Paper: Parametric Delay-margin Maximization of Consensus Network Using Local Control Scheme -... https://www.mdpi.com/2673-7264/4/3/16 Packed Bed Thermal Energy Storage System: Parametric Study The use of thermal energy storage (TES) contributes to the ongoing process of integrating various types of energy resources in order to achieve cleaner, more... thermal energy storagepackedbedsystemparametric https://userapps.support.sap.com/sap/support/knowledge/en/3320572 3320572 - Item category field doesn't defaulted from CEME when requesting a Service Parametric... When requesting a partial service item on Guided Buying the Item Category field is not defaulting the expected value from the CEME file. https://www.mdpi.com/2071-1050/15/7/6304 A Study on the Parametric Design Parameters That Influence Environmental Ergonomics and... The parametric design applied to the built environment is critical to creating sustainable and resilient spaces. However, this research field involves a vast... a studyon theparametric design https://researchconnect.buffalo.edu/en/publications/in-silico-analysis-of-curve-fitting-in-angiographic-parametric-im/ In-Silico Analysis of Curve Fitting in Angiographic Parametric Imaging in Intracranial Aneurysms to... in silicocurve fitting https://de.mathworks.com/help/ecoder/qualcommhexagon/ug/qualcomm-parametric-audio-example.html Parametric Audio Equalizer for Qualcomm Hexagon DSP - MATLAB & Simulink Generate and run optimized code for a three-band parametric audio equalizer on Qualcomm Hexagon Simulator. audio equalizerparametricqualcommhexagondsp https://www.lastparametrics.com/ Make your design parametric | Last parametrics | Prague make your designparametriclastprague https://digital.library.adelaide.edu.au/items/468ab600-ac9b-4206-b341-784dd3432e9c Parametric optimization of a Rankine cycle based waste heat recovery system for a 1.1 MW... In this study, a 1.1 MW diesel-gen-set is used to design a Waste Heat Recovery (WHR) system to generate additional power using Rankine cycle (RC). A computer... waste heat recovery system https://www.microchip.com/en-us/products/selection-tools/parametric-search-landing-page/user-guide Parametric Search Tool User Guide | Microchip Technology We have several tools to help you find the product that fits your design, including our Parametric Search Tool, LDO Selector Guide, and Advanced Parts Selector. parametric searchuser guidetoolmicrochiptechnology https://www.microchip.com/en-us/parametric-search/3977 Parametric Search | Microchip Technology parametric searchmicrochiptechnology