Robuta

https://www.permafrost.org/ Home - International Permafrost Association Jul 16, 2021 - The International Permafrost Association promotes research in permafrost and permafrost-related fields within the global scientific and engineering communities... internationalpermafrostassociation https://greenleafexpress.io/product/aaa-permafrost-smalls/ AAA+ Permafrost Smalls - GreenLeaf Express Feb 7, 2024 - AAA+ Permafrost Smalls - 23% THC LIMITED BULK Use Bulk5 for an additional 5% off bulk orders (QP+) SPLIT A QP WITH YOUR FRIENDS AND SAVE BIG! The high hits you... aaapermafrostsmallsgreenleafexpress https://emporium.calmera.com.br/?characters/Permafrost Permafrost - Characters - Calmera Servers Tibia is a free massive multiplayer online role playing game (MMORPG). permafrostcharacterscalmeraservers https://scholarworks.alaska.edu/uaf_permafrost/16/ "Permafrost, Vol. 09, No. 1 (Winter 1986-87)" by N/A Alaska Association for the Arts By N/A Alaska Association for the Arts, Published on 04/17/86 https://open.library.ubc.ca/soa/cIRcle/collections/ubctheses/24/items/1.0362380 Cryohydrogeology of a covered waste rock pile in a permafrost environment : large scale field... Learning, knowledge, research, insight: welcome to the world of UBC Library, the second-largest academic research library in Canada. https://www.woodwellclimate.org/project/cop27/permafrost/ Accounting for permafrost thaw - Woodwell Climate accountingpermafrostthawclimate https://www.piffinten.com/2026/01/Permafrost.html PiffinTen - THE Authority on Cannabis: Permafrost: The Arctic Blast Permafrost is a sativa-dominant hybrid (70/30) that was created by Rogue Buds by combining 2 legends, (Trainwreck x White Widow). Learn more here: the authoritycannabispermafrostarcticblast https://debatecallejero.com/category/articulos/i-permafrost/ I. Permafrost | Debate Callejero permafrostdebatecallejero https://page21.arcticportal.org/index.php/news Page21 - Changing Permafrost in the Arctic and its Global Effects in the 21st Century - News PAGE21 will aim to understand and quantify the vulnerability of permafrost environments to a changing global climate, and to investigate the feedback... in the arctic https://tipping-series-permafrost.confetti.events/ PERMAFROST: Tipping Elements, Irreversibility, and Abrupt Change The role of permafrost in tipping elements, irreversibility, and abrupt change in the Earth system. permafrosttippingelementsirreversibilityabrupt https://simonjanelle.com/permafrost Simon Janelle - Permafrost simonjanellepermafrost https://apgc.awi.de/dataset/?amp=&organization=pangaea&groups=properties-extent&institute=Max+Planck+Institute+for+Biogeochemistry%2C+Jena%2C+Germany&tags=Active+Layer+Depth&res_format=HTML&res_format=PNG&s_resolution=0.5+degree®ion=Yakutia&product=Active+layer+depth&res_format=NetCDF Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://www.flyhighdiscsupply.com/product-page/prodigy-pa-3-300-glow-gannon-buhr-permafrost-stamp Prodigy PA-3 300 GLOW - Gannon Buhr Permafrost Stamp | Fly High Disc Supply Prodigy released the Permafrost stamp on D1s, which was Gannon Buhr's Signature Series disc throughout the year. We heard from some of you that you wanted to... https://permafrost.gi.alaska.edu/site/cpr Caribou-Poker creek (C4new, Poker1) | Permafrost Laboratory cariboupokercreekpermafrostlaboratory https://publications.slu.se/?file=publ/show&id=96983&lang=se High riverine CO2 emissions at the permafrost boundary of Western Siberia | SLU:s... The fate of the vast stocks of organic carbon stored in permafrost of the Western Siberian Lowland, the world's largest peat-land, is uncertain. Spec https://apgc.awi.de/dataset/?amp=&s_resolution=0.5+degree&res_format=NetCDF&res_format=HTML&tags=Permafrost&tags=Active+Layer+Depth&first_author=Beer%2C+Christian®ion=Yakutia Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://epic.awi.de/id/eprint/44996/ Report from the International Permafrost Association: Eleventh International Conference on... ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... from thereportinternationalpermafrostassociation https://www.chimicamo.org/tag/permafrost/ permafrost Archivi - Chimicamo permafrostarchivi https://ualberta.scholaris.ca/items/efa6e3d4-9bd2-4c94-8f29-a7456c6c8e9d Quantifying long term changes in organic matter sequestration for carbon management: permafrost... long termorganic matter https://www.uarctic.org/news/2025/2/a-transdisciplinary-comparative-analysis-reveals-key-risks-from-arctic-permafrost-thaw/ A transdisciplinary, comparative analysis reveals key risks from Arctic permafrost thaw The Nunataryk EU-funded project researchers, many of whom are also members of Thematic Network of Health and Wellbeing in the Arctic, recently published an... comparative analysiskey riskstransdisciplinaryreveals https://gmd.copernicus.org/articles/11/2475/2018/gmd-11-2475-2018-assets.html GMD - Assets - PIC v1.3: comprehensive R package for computing permafrost indices with daily... Abstract. An R package was developed for computing permafrost indices (PIC v1.3) that integrates meteorological observations, gridded meteorological datasets,... https://epic.awi.de/id/eprint/38457/ Mid-Wisconsin to Holocene Permafrost and Landscape Dynamics based on a Drained Lake Basin Core from... ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... https://www.frontiersin.org/journals/environmental-science/articles/10.3389/fenvs.2022.892925/full Frontiers | Hydrologic Controls on Peat Permafrost and Carbon Processes: New Insights From Past and... Soil carbon (C) in permafrost peatlands is vulnerable to decomposition with thaw under a warming climate. The amount and form of C loss likely depends on the... https://apgc.awi.de/dataset/?amp=&s_resolution=0.5+degree&res_format=NetCDF&product=Active+layer+depth&tags=Active+Layer+Depth&groups=properties-extent&institute=Max+Planck+Institute+for+Biogeochemistry%2C+Jena%2C+Germany&first_author=Beer%2C+Christian Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://polarjournal.net/permafrost-not-cause-of-oil-spill-in-norilsk/ Permafrost not cause of oil spill in Norilsk | Polar Journal The reason for the spill of diesel fuel in Norilsk was violations during the construction and operation of the tank plant. oil spillpermafrostcausenorilskpolar https://www.klimawandelanpassung.at/newsletter/kwa-nl3/kwa-permanet PermaNET: Alpenraumprojekt untersucht Permafrost und seine Veränderungen durch den Klimawandel permafrostundseinedurchden https://apgc.awi.de/dataset/?amp=&tags=Active+Layer+Depth&tags=Permafrost&institute=Max+Planck+Institute+for+Biogeochemistry%2C+Jena%2C+Germany&groups=properties-extent&organization=pangaea&res_format=PNG&product=Active+layer+depth&first_author=Beer%2C+Christian&s_resolution=0.5+degree Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://permafrost.gi.alaska.edu/biblio/thermal-state-permafrost-north-america-contribution-international-polar-year Thermal state of permafrost in North America: a contribution to the international polar year |... https://permafrost.woodwellclimate.org/sue-natali-how-ancient-arctic-carbon-threatens-everyone-on-the-planet/ Sue Natali: How ancient Arctic carbon threatens everyone on the planet - Permafrost Pathways https://www.ulethbridge.ca/unews/article/u-l-geographers-observe-climate-related-tipping-point-accelerated-permafrost-thaw U of L geographers observe climate-related tipping point to accelerated permafrost thaw | UNews u of l https://www.woodwellclimate.org/41-million-grant-for-permafrost-thaw-monitoring/ $41M Audacious Grant Will Tackle Permafrost Thaw - Woodwell Climate Apr 15, 2022 - Permafrost thaw is a ticking climate time bomb. A $41M Audacious Project grant, has dedicated $41M to combatting permafrost emissions. audaciousgranttacklepermafrostthaw https://apgc.awi.de/dataset/?amp=&tags=Permafrost&organization=pangaea&res_format=HTML&res_format=NetCDF&product=Active+layer+depth&first_author=Beer%2C+Christian®ion=Yakutia&groups=properties-extent Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://permafrost.woodwellclimate.org/arctic-permafrost-carbon-and-global-climate-models/ Arctic permafrost carbon and global climate models - Permafrost Pathways permafrost carbonglobal climatearcticmodelspathways https://www.arctic.ac.uk/projects/permafrost-catchments-in-transition-hydrological-controls-on-carbon-cycling-and-greenhouse-gas-budgets-8/ Permafrost catchments in transition: hydrological controls on carbon cycling and greenhouse gas... in transition https://gwfnet.net/MetadataEditor/Index/T-2023-11-06-y1NLj9kCWDU6y3wmZJCVbqgA Editing Challenges in Hydrologic-Land Surface Modeling of Permafrost Signatures - A Canadian... Editing record with title Challenges in Hydrologic-Land Surface Modeling of Permafrost Signatures - A Canadian Perspective https://www.samzipper.com/publication/lamontagne-halle-changing-2018/ Changing groundwater discharge dynamics in permafrost regions | HEAL Dec 22, 2019 - Permafrost thaw due to climate warming modifies hydrological processes by increasing hydrological connectivity between aquifers and surface water bodies and... changinggroundwaterdischargedynamicspermafrost https://experts.colorado.edu/display/pubid_301072 Boreal peatland C fluxes under varying permafrost regimes | CU Experts | CU Boulder borealpeatlandcfluxes https://gtnp.arcticportal.org/karten-und-graphiken/8-news/129-measurement-recommendations-and-guidelines Global Terrestrial Network for Permafrost (GTN-P) - Measurement Recommendations and Guidelines GTN-P is the primary international programme concerned with monitoring permafrost parameters globalterrestrialnetworkpermafrost https://collaborate.princeton.edu/en/projects/the-impact-of-global-warming-on-the-carbon-cycle-of-arctic-permaf/ The Impact of Global Warming on the Carbon Cycle of Arctic Permafrost: An Experimental and Field... https://permafrost.gi.alaska.edu/biblio/icesat-derived-elevation-changes-lena-delta-and-laptev-sea-siberia-0 ICESat-Derived Elevation Changes on the Lena Delta and Laptev Sea, Siberia | Permafrost Laboratory https://epic.awi.de/id/eprint/22777/ Subsea Permafrost Degradation in the Western Laptev Sea (NE Siberia) | EPIC ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... in thelaptev seasubseapermafrostdegradation https://www.eea.europa.eu/en/analysis/maps-and-charts/permafrost-in-the-northern-hemisphere/ Permafrost in the Northern hemisphere | Maps and charts | European Environment Agency (EEA) The Arctic region is undergoing change; a rapid change compared to other parts of the globe. The change is primarily driven by climate change and the effects... maps and chartseuropean environment agencyin thenorthern hemisphere https://media.arcus.org/album/polartrec-2019-david-walker/30606 David in permafrost pit | Polar Media Archive davidpermafrostpitpolarmedia https://eo4society.esa.int/results/advancing-the-arctic-methane-permafrost-challenge-ampac-with-future-satellite-missions/ Advancing the Arctic Methane Permafrost Challenge (AMPAC) With Future Satellite Missions - eo... the arctic https://permafrost.woodwellclimate.org/between-land-and-water-tribal-relocation-and-resistance/ Between Land and Water: Tribal Relocation and Resistance - Permafrost Pathways land and watertribalrelocationresistancepermafrost https://experts.nau.edu/en/publications/potential-carbon-release-from-permafrost-soils-of-northeastern-si/fingerprints/?sortBy=alphabetically Potential carbon release from permafrost soils of Northeastern Siberia - Fingerprint - Northern... potentialcarbonreleasepermafrost https://epic.awi.de/id/eprint/17398/ Quaternary vegetation changes derived from a loess-like permafrost palaeosol sequence in northeast... ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... https://www.tac-atc.ca/en/knowledge-centre/technical-resources-search/publications/ptm-permafrost-e/ Guidelines for Development and Management of Transportation Infrastructure in Permafrost Regions... Aug 30, 2024 - These guidelines provide a compendium of best practices for the development, planning, design, construction management, maintenance and rehabilitation of... transportation infrastructureguidelinesdevelopmentmanagement https://gtnpdatabase.org/ Global Terrestrial Network for Permafrost - Database The Global Terrestrial Network for Permafrost (GTN-P) Data Management System contains both Metadata and Quality Controlled Data about Permafrost Temperatures... globalterrestrialnetworkpermafrostdatabase https://www.truthdig.com/articles/scientists-peer-into-mysteries-of-carbon-release-from-permafrost/ Scientists Peer Into Mysteries of Carbon Release From Permafrost - Truthdig Jun 25, 2017 - The frozen soil of the northern polar regions holds billions of tonnes of organic carbon -- and global warming could speed its escape into the atmosphere. scientistspeermysteriescarbonrelease https://agu.confex.com/agu/fm14/webprogram/Paper18980.html Abstract: Supra-permafrost Subsurface Flow on the Arctic Coastal Plain of Alaska (2014 AGU Fall... https://www.temcompany.com/de/tag/permafrost-mapping/ Permafrost-Kartierung Archive | temcompany.com permafrostarchivetemcompany https://www.illuq.eu/news/atlas ILLUQ - Arctic Permafrost Atlas ILLUQ is a EU funded pemfafrost research project. arcticpermafrostatlas https://apgc.awi.de/dataset/?product=Subsoil+temperatures&=&s_resolution=0.5+degree&tags=Subsoil+Temperature&res_format=NetCDF&res_format=PNG Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://digitalcommons.usu.edu/engineering_news/296/ "New Findings of Controls on Carbon Export in Permafrost Terrain | Coll" by USU College of... After two decades of collecting data, a team of researchers discovered new ways in which groundwater moves and controls the export of carbon from land to... https://www.imsa.edu/tag/permafrost-thaw-in-relation-to-the-varied-photosynthetic-pathways-and-abundance-of-chlorophytum-comosum/ Permafrost Thaw in Relation to the Varied Photosynthetic Pathways and Abundance of Chlorophytum... in relation to https://www.temcompany.com/pt/tag/permafrost-mapping/ Arquivos de mapeamento do permafrost | temcompany.com arquivosdemapeamentopermafrosttemcompany https://www.hell-is-open.de/images/bildergalerie/details.php?image_id=5824 London, Purple Turtle, 19.09.2009, Besatt, Daemonolith, Permafrost, Ghast :: Hell-is-open - Image... Necrosadistic Goat Torture. https://www.ngee-arctic.ornl.gov/publications/doi-10.1088/1748-9326/abc444 Changes in precipitation and air temperature contribute comparably to permafrost degradation in a... Gaining a predictive understanding of Arctic ecosystems air temperature https://permafrost.gi.alaska.edu/content/collaborations Collaborations | Permafrost Laboratory collaborationspermafrostlaboratory https://psecco.org/resource/permafrost-and-periglacial-processes Permafrost and Periglacial Processes | Polar Science Early Career Community Office early career communitypermafrostprocessespolarscience https://www.moment-permafrost.uni-hamburg.de/en/news-container/arcticcircle.html The Arctic Circle Berlin Forum "The Arctic at Crossroad" : Project MOMENT - Permafrost research of... the arctic circle https://www.betterworld.info/climate-crisis/consequences/arctic-ice-permafrost Arctic Ice & Permafrost | Better World Info arctic icebetter worldpermafrostinfo https://research.wur.nl/en/datasets/rewilding-risks-for-peatland-permafrost/ Rewilding Risks for Peatland Permafrost - Wageningen University & Research wageningen universityrewildingriskspeatlandpermafrost https://www.gwfnet.net/Metadata/Record/T-2023-01-04-e1JBr20xJrUCpkU1JOW47Qg Advances in Permafrost Modelling: Enhancing MESH/CLASS to represent Permafrost Dynamics Advances in Permafrost Modelling: Enhancing MESH/CLASS to represent Permafrost Dynamics advancespermafrostmodellingenhancingmesh https://www.climatecodered.org/2012/04/triggering-permafrost-meltdown-is.html?m=0 Climate Code Red: Triggering permafrost meltdown is closer than we think The climate emergency requires actions at emergency speed for a rapid transition to a post-carbon, safe-climate future. code redclimatetriggeringpermafrost https://www.terradaily.com/reports/Thawing_Permafrost_Could_Accelerate_Climate_Change_By_Century_End_999.html Thawing Permafrost Could Accelerate Climate Change By Century End Berkeley CA (SPX) Aug 24, 2011 - Billions of tons of carbon trapped in high-latitude permafrost may be released into the atmosphere by the end of this century... climate changeby centurythawingpermafrostcould https://epic.awi.de/id/eprint/42533/ Thermokarst dynamics in central-eastern Beringia: Insights from permafrost and lacustrine sediment... ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... https://apgc.awi.de/dataset/?amp=&s_resolution=0.5+degree&tags=Active+Layer+Depth&tags=Permafrost&institute=Max+Planck+Institute+for+Biogeochemistry%2C+Jena%2C+Germany&res_format=PNG&res_format=HTML&organization=pangaea&product=Active+layer+depth Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://2018.pege.org/08-12/german.htm Problem Permafrost Newsletter der PEGE.org in 2018-08-12 problempermafrost https://goodbookclub.co.uk/permafrost_9781911508755 Permafrost by Eva Baltasar | & Other Stories Press | Good Book Club Full of powerful, physical imagery, this prize-winning debut novel by acclaimed Catalan poet Eva Baltasar was a word-of-mouth hit in its own language. other storiesgood bookpermafrostevabaltasar https://www.open.edu/openlearn/nature-environment/environment-understanding-atmospheric-and-ocean-flows/content-section-5.3 Environment: understanding atmospheric and ocean flows: 5.3 Permafrost | OpenLearn - Open University What affects the atmospheric and ocean flows? This free course, Environment: understanding atmospheric and ocean flows, explores the mechanisms that are... https://apgc.awi.de/dataset/?amp=&tags=Permafrost&tags=Active+Layer+Depth&groups=properties-extent&first_author=Beer%2C+Christian Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://apgc.awi.de/dataset/?amp=&organization=pangaea&res_format=PNG&product=Subsoil+temperatures Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://english.nieer.cas.cn/ns/ue/202409/t20240923_690333.html 12th International Symposium on Permafrost Engineering----Northwest Institute of Eco-Environment... international symposiumpermafrost https://www.greenious.it/tag/permafrost/ permafrost | Greenious permafrost https://archive.kuow.org/2021-08-16/as-the-permafrost-in-siberia-thaws-interesting-things-are-being-discovered As The Permafrost In Siberia Thaws, Interesting Things Are Being Discovered interesting thingspermafrostsiberia https://www.investigatewest.org/methane-bubbles-out-from-permafrost-to-enhance-global-warming/ Methane bubbles out from permafrost to enhance global warming Aug 6, 2025 - For the second day in a row, we have some really disturbing news coming out of the Far North regarding the pace at which climate change is hurtling forward.... methanebubblespermafrostenhanceglobal https://www.permafrost.org/conference-proceedings/ Conference Proceedings - International Permafrost Association Jan 13, 2025 - International Conferences To see more information about the international conferences, see events. Regional Conferences To see more information about the... conference proceedingsinternationalpermafrostassociation https://yamz.net/term/ark:99152/h5982 YAMZ Term- Saline permafrost yamztermsalinepermafrost https://dggs.alaska.gov/pubs/id/29566 GB 11 - Guidebook to permafrost and Quaternary geology of the Fairbanks area, Alaska https://www.uaf.edu/permafrostmag/nonfiction.php Nonfiction | Permafrost Magazine Comprehensive collection of published nonfiction from the online issues of Permafrost Magazine nonfictionpermafrostmagazine https://catalog.data.gov/dataset/minimal-offshore-extent-of-ice-bearing-subsea-permafrost-on-the-u-s-beaufort-sea-margin Department of the Interior - Minimal offshore extent of ice-bearing (subsea) permafrost on the U.S.... The present-day distribution of subsea permafrost beneath high-latitude continental shelves has implications for sea level rise and climate change since the... department of the interior https://science-gazette.com/as-subsurface-permafrost-thaws-rapid-changes-to-the-arctic-seabed-are-seen/ As subsurface permafrost thaws, rapid changes to the Arctic seabed are seen - Science Gazette May 1, 2022 - A new study led by MBARI experts and colleagues is the first to show how the melting of permafrost, which... https://www.toplitz-productions.com/news-2388/playable-demos-for-permafrost-and-industry-giant-4-0-set-steam-next-fest-on-fire.html?page_n167=2 Playable Demos For Permafrost And Industry Giant 4.0 On Steam Next Fest - Toplitz Productions GmbH Enjoy the time-limited chance to try some of the highly anticipated games from Toplitz Productions https://tlcodex.com/us/item/10752015/ Permafrost Shoes - Items - Throne and Liberty Codex Throne and Liberty Codex - the most complete and up to date database for Throne and Liberty! throne and libertypermafrostshoesitemscodex https://www.citationmachine.net/permafrost-and-periglacial-processes/cite-a-digital Free Citing a Digital File in PERMAFROST-AND-PERIGLACIAL-PROCESSES | Citation Machine Creating accurate citations in PERMAFROST-AND-PERIGLACIAL-PROCESSES has never been easier! Automatically cite a digital file in... a digital https://www.usgs.gov/media/videos/usgs-using-drones-measure-methane-escaping-arctic-permafrost-aug-2023 USGS using drones to measure methane escaping Arctic permafrost - Aug 2023 | U.S. Geological Survey As permafrost soils in the Arctic warm and thaw, greenhouse gases including methane are released into the atmosphere. USGS Ecologist Kristen Manies of the USGS... https://page21.arcticportal.org/news/211-2nd-circular-now-out-for-the-global-warming-and-the-human-nature-dimension-in-siberia-conference Page21 - Changing Permafrost in the Arctic and its Global Effects in the 21st Century - 2nd... PAGE21 will aim to understand and quantify the vulnerability of permafrost environments to a changing global climate, and to investigate the feedback... in the arctic https://nunataryuk.org/news/permafrost-days-2023-local-workshop-in-nwt-canada Nunataryuk - Permafrost Days 2023 - local workshop in NWT Canada Nunataryuk is a EU funded pemfafrost research project. permafrostdayslocalworkshopnwt https://giab-online.ru/en/catalog/osobennosti-skvazhinnogo-podzemnogo-vyshchelachivaniya-v-kriolit Features of in-situ leaching in the permafrost zone of the Khiagda ore field in situfeaturesleaching https://www.odnako.org/a-prehistoric-worm-found-in-siberian-permafrost-comes-back-to-life-after-46000-years/ A prehistoric worm found in Siberian permafrost comes back to life after 46,000 years Feb 28, 2024 - Deep in the Siberian permafrost, a tiny Pleistocene inhabitant has awakened after a thousand-year sleep. It is a female nematode, a microscopic worm that has... https://independentpublishers.org.au/book-of-the-year-award/book-of-the-year-award-2022-shortlist/permafrost/ Permafrost - The Small Press Network Oct 21, 2022 - Permafrost (UQP) is a collection of stories that delve into uncomfortable spaces that lie beneath familiar experiences of travel, love and loss. small presspermafrostnetwork https://apgc.awi.de/dataset/?amp=&first_author=Beer%2C+Christian&organization=pangaea&tags=Active+Layer+Depth&tags=Permafrost&res_format=HTML&res_format=PNG&res_format=NetCDF&groups=properties-extent Dataset - Arctic Permafrost Geospatial Centre datasetarcticpermafrostgeospatialcentre https://media.arcus.org/topic/permafrost?page=7 Permafrost | Polar Media Archive permafrostpolarmediaarchive https://www.norceresearch.no/en/projects/permarich-advanced-mapping-and-monitoring-for-assessing-permafrost-thawing-risks-for-modern-infrastructure-and-cultural-heritage-in-svalbard PermaRICH: Advanced Mapping and Monitoring for Assessing Permafrost Thawing Risks for Modern... advancedmappingmonitoring https://epic.awi.de/id/eprint/55281/ Applying Computed Tomography (CT) scanning for segmentation of permafrost constituents in drill... ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... computed tomographyct scanning https://epic.awi.de/id/eprint/13007/ Offshore permafrost and gas hydrate stability zone on the shelf of East Siberian Seas | EPIC ePIC (electronic Publication Information Center) is the official repository for publications and presentations of Alfred Wegener Institute for Polar and Marine... https://themorningnews.com/news/tag/siberian-permafrost/ Siberian permafrost Archives - The Morning News the morningsiberianpermafrostarchivesnews https://permafrost.su/morozov-ap-moskvin-yup-changes-water-thermal-regime-permafrost-swamps-western-siberia-response Morozov A.P., Moskvin Yu.P. Changes in the water-thermal regime of permafrost swamps in Western...