Robuta

https://stake-fr.com/ Suspected Phishing | Cloudflare suspectedphishingcloudflare https://openphish.com/ OpenPhish - Phishing Intelligence OpenPhish provides actionable intelligence data on active phishing threats. phishing intelligence https://phishingquiz.withgoogle.com/ Jigsaw | Phishing Quiz Can you spot when you're being phished? phishing quizjigsaw https://impressions.manipal.edu/open-access-archive/14154/ "Enhancing Phishing Detection: A Machine Learning Approach With Feature" by Ganesh S. Nayak,... With the rise in cybercrime, phishing remains a significant concern as it targets individuals with fake websites, causing victims to disclose their private... phishing detectiona machinelearning approachenhancingfeature https://www.westjet.com/en-ca/news/2021/westjet-warns-public-of-new-phishing-email-scams WestJet warns public of new phishing email scams WestJet is warning the public of new email scams using the WestJet name and brand likeness combined with a time-sensitive discount voucher to get recipients to... phishing emailwestjetwarnspublicnew https://antiphishing.biz/2025/07/26/united-overseas-bank-limited-uob-phishing-page-revealed/ United Overseas Bank Limited (UOB) phishing page revealed - Antiphishing.biz Apr 1, 2026 - A high-fidelity phishing campaign targeting United Overseas Bank (UOB) users in Southeast Asia utilizes fraudulent SMS and email links to harvest login... united overseas banklimiteduobphishingrevealed https://learn.microsoft.com/en-us/microsoft-365/admin/security-and-compliance/m365b-users-phishing-spam-malware?view=o365-worldwide Protect users against phishing and other attacks - Microsoft 365 admin | Microsoft Learn Protect against phishing and other attacks with Microsoft 365 Business Premium. protectusersphishingattacksmicrosoft https://www.lbcc.edu/phishing Phishing - Long Beach City College Office of Information Security long beachcity collegephishing https://phish.report/IOK/indicators/smbc-9776441 SMBC Phishing Kit 9776441 - phish.report Detects a SMBC phishing kit targeting Japanese users. phishing kitsmbcreport https://fakeinet.com/clothingnfashion-ru-tienda-online-dudosa-parfois/ clothingnfashion.ru tienda online dudosa Parfois - Fakes, tiendas dudosas, phishing... Aug 15, 2022 - clothingnfashion.ru es una tienda online dudosa de productos de Parfois. Muchos descuentos pero mejor lee esto antes de comprar. tienda onlineruparfoisfakestiendas https://westoba.com/news/collabria-alert-potential-phishing-site/ Collabria Alert: Potential Phishing Site - Westoba collabriaalertpotentialphishingsite https://jateng.antaranews.com/berita/528624/waspadai-modus-pencurian-data-priibadi-melalui-phishing Waspadai modus pencurian data priibadi melalui phishing - ANTARA News Jateng Modus pencurian data pribadi melalui phishing adalah kejahatan dunia digital yang berbahaya dan akhir-akhir ini marak terjadi melalui media sosial, salah... antara newsmoduspencuriandataphishing https://www.govtech.com/security/phishing-remains-persistent-threat-in-k-12-cybersecurity Phishing Remains Persistent Threat in K-12 Cybersecurity Sep 23, 2025 - The education sector has seen a swift rise in cybersecurity incidents since 2024, but training, awareness and tools can help ease incidents and response time. phishingremainspersistentthreatk https://www.exploitone.com/mobile-security/hackers-steal-facebook-messenger-login-credentials-via-massive-phishing-campaign/ Hackers steal Facebook Messenger login credentials via massive phishing campaign Apr 20, 2021 - Hackers steal Facebook Messenger login credentials via massive phishing campaign - Mobile Security Cyber Security News | Exploit One | Hacking News facebook messengerlogin credentialshackersstealvia https://www.a-i3.org/2017/12/ganz-und-gar-nicht-sicher-immer-mehr-phishing-webseiten-setzen-auf-https/ Ganz und gar nicht sicher: Immer mehr Phishing-Webseiten setzen auf HTTPS | a-i3.org ganzundgarnichtsicher https://indico.global/event/14045/page/4940-warning-phishing-global-travel-experts 2nd AstroORDAS Workshop and ACME WP4 meeting (8-December 12, 2025): Warning: Phishing Global Travel... WARNING: phishing attempts from Global Travel Experts (more info here) We would like to announce a week-long workshop on online research data analysis services... global travelworkshopacmemeetingdecember https://isc.sans.edu/diary/28984 Paypal Phishing/Coinbase in One Image - SANS ISC Paypal Phishing/Coinbase in One Image, Author: Xavier Mertens one imagesans iscpaypalphishingcoinbase https://thecentexitguy.com/phishing-3-0-sophisticated-social-engineering-in-the-enterprise/ Phishing 3.0: Sophisticated Social Engineering in the Enterprise Aug 29, 2025 - Phishing 3.0 is reshaping enterprise threats with AI-driven tactics and advanced social engineering. Learn how attackers exploit trust, and what defenses... in the enterprisesocial engineeringphishingsophisticated https://developer.nvidia.com/blog/designing-a-new-net-for-phishing-detection-with-nvidia-morpheus/ Designing a New Net for Phishing Detection with NVIDIA Morpheus | NVIDIA Technical Blog Jun 2, 2022 - With NVIDIA Morpheus, now available for download, you can achieve up to 99% accuracy for phishing detection, using AI. phishing detectiontechnical blogdesigningnewnvidia https://www.datamation.com/security/online-phishing-scams-exploding/ Online Phishing Scams Exploding | Datamation Jan 28, 2021 - Identity theft has taken a bad turn with the number of phishing scams increasing nearly 800-fold over the last 10 months. Last September, there were 279 phishing scamsonlineexplodingdatamation https://ijarcce.com/papers/phishing-websites-prediction-based-on-artificial-neural-network-technique/ Phishing Websites Prediction based on Artificial Neural Network Technique | Peer-reviewed Journal Abstract- Phishing attacks have emerged as a significant threat to online security, targeting unsuspecting users to divulge sensitive information through... artificial neural networkpeer reviewed journalbased onphishingwebsites https://www.cybersecurityup.it/knowledge-hub/news/cyber-attacchi-xdspy-phishing-e-malware-sconvolgono-russia-e-moldova Cyber Attacchi XDSpy: Phishing e Malware Sconvolgono Russia e Moldova Un gruppo di cyber spionaggio poco conosciuto, denominato XDSpy, ha recentemente preso di mira aziende in Russia e Moldova attraverso una... cyberattacchiphishingmalwarerussia https://uctechnews.ucop.edu/tag/phishing/ Phishing | UC Tech News tech newsphishinguc https://www.tectack.org/2026/02/tenga-confirms-customer-data-spill.html TENGA Confirms Customer Data Spill After Phishing Compromised an Employee Inbox TENGA Confirms Customer Data Spill After Phishing Compromised an Employee Inbox customer dataan employeetengaspillphishing https://phishdestroy.io/ru/domain/profitabletrade.xyz/ profitabletrade.xyz Phishing Attempt Shut Down Quickly May 13, 2026 - profitabletrade.xyz was a low-risk phishing site now offline. Avoid sharing personal info or credentials w... Site title: "Profitable Trade Digital Ce...". shut downxyzphishingattemptquickly https://gulfpress.net/uae-more-than-50-of-residents-are-victims-of-phishing-sites-nearly-20-targeted-by-social-media-scams/ UAE: More than 50% of residents are victims of phishing sites, nearly 20% targeted by social media... May 20, 2024 - The UAE Cyber Security Council recently reported that a significant number of individuals and businesses fell victim to cyber attacks in the third quarter more thansocial mediauaeresidentsvictims https://www.teamviewer.com/apac/insights/it-news-research-roundup-floppy-discs-phishing/ Floppy discs, vague tickets, and phishing training | TeamViewer Dec 17, 2025 - Read on to learn why Cambridge library technicians care so much about the humble floppy. But first, a handful of fascinating IT news and research items from... floppy discsphishing trainingvagueticketsteamviewer https://blog.knowbe4.com/uk-national-lottery-hacked-watch-out-for-phishing-attacks-on-millions-of-customers UK National Lottery hacked: Watch Out For Phishing Attacks On Millions Of Customers UK National Lottery hacked: Watch Out For Phishing Attacks On Millions Of Customers uk national lotterywatch outphishing attackshackedmillions https://www.megaupdate24.com/tag/best-phishing-simulation/ Best Phishing Simulation phishing simulationbest https://www.syschat.com/gmail-users-warned-new-phishing-scheme-1009.html Gmail users warned of new phishing scheme - SysChat Gmail users warned of new phishing scheme News gmailuserswarnednewphishing https://www.dbdigest.com/2020/10/phishing-45-of-global-remote-workers.html Data Breaches Digest: Phishing: 45% Of Global Remote Workers Ignore Training And Open Emails They... Daily Digest of Global Data Breaches and Cyber Security News and Advice data breachesremote workersdigestphishingglobal https://www.hklaw.com/en/events/2019/11/business-email-compromise-and-phishing-prevention-and-response Business Email Compromise and Phishing: Prevention and Response for Lawyers | Events | Holland &... In a one-hour briefing webinar for PLI, Cybersecurity, Data Privacy and Intellectual Property Attorney Mark Francis will provide key takeaways from recent... business email compromisephishing preventionfor lawyersresponseevents https://www.computerweekly.com/news/252484788/Check-Point-uncovers-targeted-Microsoft-Office-365-phishing-campaign?_gl=1*144lcee*_ga*MjUxNTM0Mzg0LjE2MzAwMDgxNjE.*_ga_TQKE4GS5P9*MTYzMDAwODE2MS4xLjEuMTYzMDAwODE4NS4w&_ga=2.23536826.1008818071.1629842553-68222631.1628548745 Check Point uncovers targeted Microsoft Office 365 phishing campaign | Computer Weekly Organised criminal campaign exploited Adobe, Oxford University and Samsung web domains to trick users into giving up their passwords check pointmicrosoft officecomputer weeklytargetedphishing https://scampolicegroup.com/romance-scam-advance-fee-fraud-phishing-david-hudson/ Romance Scam/Advance Fee Fraud/Phishing: DAVID HUDSON - Scampolice Group May 20, 2019 - Romance scammer DAVID HUDSON is using stolen photos of a decent person which are commonly seen and abused. Read other posts on our website and also the... advance fee fraudromance scamdavid hudsonphishinggroup https://www.windowsobserver.com/2011/02/27/unique-phishing-by-email-attempt/ Unique Phishing By Email Attempt | WindowsObserver.com by emailuniquephishingattempt https://cybersecurityminute.com/human-factors-in-cybersecurity/germany-probes-russia-linked-signal-phishing-of-officials/ Germany Probes Russia-Linked Signal Phishing of Officials | CyberSecurity Minute Apr 27, 2026 - A single QR code, framed as emergency support inside a trusted app, quietly unlocked weeks of sensitive conversation as German federal prosecutors opened an... germanyprobesrussialinkedsignal https://classiccmp.org/pipermail/cctalk/2022-April/063359.html phishing increase lately phishingincreaselately https://www.bvmw.de/de/internet-und-digitalisierung/checkliste-phishing-mails-erkennen-und-richtig-handeln?x-craft-live-preview=1ebf05fa46447c0514981d2b3bbc77c3ee75b771812841874620bf3e72619f41jrzkndcabr Checkliste: Phishing-Mails erkennen und richtig handeln - BVMW DE Erfahren Sie in unserer Checkliste, wie Sie und Ihre Mitarbeitenden Phishing-E-Mails erkennen und wie Sie im Verdachtsfall umgehen sollten? phishing mailschecklisteerkennenundrichtig https://www.ndss-symposium.org/ndss-paper/auto-draft-508/ Exploring Phishing Threats through QR Codes in Naturalistic Settings - NDSS Symposium phishing threatsqr codesexploringnaturalisticsettings https://www.lowyat.net/2017/130859/google-shuts-massive-google-docs-phishing-campaign/ Google Shuts Down Massive Google Docs Phishing Campaign - Lowyat.NET May 4, 2017 - A phishing scam using an elaborate facsimile of Google Docs has been shut down. googlemassivedocsphishingcampaign https://www.onlinethreatalerts.com/article/2019/10/6/usaa-bank-policy-updates-phishing-scam/ USAA Bank Policy Updates Phishing Scam The email message below with the subject Notice of Policy Updates, was NOT sent by USAA. The phishing ema... usaa bankpolicy updatesphishing scam https://www.privacy.com.sg/resources/phishing-emails/ The Menace of Phishing Emails and How to Stay Secure - Privacy Ninja Nov 9, 2023 - Stay informed about Phishing Emails and know how to stay secure. how to stayphishing emailsmenacesecureprivacy https://www.altusintel.com/public-yychwm/ Tycoon2fa Elevates Phishing, Renders Security Useless | Altus Intel Apr 13, 2025 - Important Updates in Tycoon2FA Phishing Platform Developers of the Tycoon2FA phishing platform have made significant advancements in bypassing phishingrenderssecurityuselessaltus https://internationalbusinessweekly.com/phishing-for-trouble-the-returning-physical-bank-token-is-no-silver-bullet/ Phishing for trouble: The returning physical bank token is no silver bullet - International... Nov 7, 2025 - Latest effort to counter phishing could rattle less-tech-savvy customers. It also needs a digital ecosystem to work silver bulletphishingtroublereturningphysical https://www.bipprime.net/avoiding-phishing-while-downloading-mp3s Avoiding Phishing While Downloading MP3s - Bip Prime Searching for the best download youtube MP3 and download youtube MP4 downloader to switch your number one recordings over completely to MP3? Look no further!... avoidingphishingdownloadingbipprime https://www.cafepress.com/+cybersecurity_0_days_without_an_incident_phishing_shower_curtain,1204881478 Cybersecurity 0 Days Without An Incident Phishing Shower Curtain | CafePress Shop Cybersecurity 0 Days Without An Incident Phishing Shower Curtain designed by T-Shirt.CONCEPTS. Lots of different size and color combinations to choose... an incidentshower curtaincybersecuritydayswithout https://mindmatters.ai/t/phishing/ Tag: Phishing | Mind Matters Tag: Phishing, at Mind Matters mind matterstagphishing https://wcoinsw.com/crypto/google-ads-data-4m-stolen-through-crypto-phishing-urls/ Google Ads data: $4M stolen through crypto phishing URLs - Wild Coins World Apr 27, 2023 - Data from Google Ads coupled with blockchain analytics reveals that over $4 million has been stolen from users that have fallen for malicious phishing websites... google adswild coinsdatastolencrypto https://radar.avrotros.nl/artikel/honderden-phishing-sites-iedere-maand-offline-16836 Honderden phishing-sites iedere maand offline | Radar Aug 23, 2015 - Nederlandse banken hebben hostingproviders dit jaar gemiddeld 470 keer per maand gevraagd een phishing-website offline te halen. Criminelen proberen via deze... phishingsitesiederemaandoffline https://www.kaspersky.de/blog/hacked-routers-dns-hijacking/19078/ Angreifer hacken Router, um Nutzer auf Phishing-Seiten umzuleiten | Offizieller Blog von Kaspersky Angreifer hacken Heimrouter, modifizieren ihre Einstellungen und leiten Nutzer unbemerkt auf Phishing-Seiten weiter, um Ihre Anmeldedaten zu stehlen. hackenrouterumnutzerauf https://research.splunk.com/endpoint/2fa9dec8-9d8e-46d3-96c1-202c06f0e6e1/ Detection: Windows Phishing PDF File Executes URL Link | Splunk Security Content Apr 15, 2026 - Updated Date: 2026-04-15 ID: 2fa9dec8-9d8e-46d3-96c1-202c06f0e6e1 Author: Teoderick Contreras, Splunk Type: Anomaly Product: Splunk Enterprise Security... pdf fileurl linkdetectionwindowsphishing https://nquiringminds.com/cybernews-summaries/4ac9c40a9b9f3b0cecd99858da84f387/ Ongoing Phishing Campaign Targets Senior Corporate Accounts in Microsoft Azure Environments |... corporate accountsmicrosoft azureongoingphishingcampaign https://www.info.gov.hk/gia/general/202412/24/P2024122400339.htm Phishing instant messages related to Bank of China (Hong Kong) Limited The following is issued on behalf of the Hong Kong Monetary Authority: The Hong Kong Monetary Authority (HKMA) wishes to alert members of the public to a press... bank of chinainstant messagesrelated tohong kongphishing https://thehackernews.com/2024/09/say-goodbye-to-phishing-must-haves-to.html?version=meter+at+null Say Goodbye to Phishing: Must-Haves to Eliminate Credential Theft Discover how Beyond Identity's deterministic security approach eliminates phishing, credential theft, and other cyber threats with passwordless, phish say goodbyemust havescredential theftphishingeliminate https://www.analyticsinsight.net/news/pi-network-phishing-alert-only-use-walletpinet-announces-core-team Pi Network Phishing Alert: Only Use wallet.pi.net, Announces Core Team Pi Network warns users about fake wallet phishing scams. Learn how to identify real Pi Wallet links and protect your crypto during Open Mainnet. pi networkphishing alertcore teamusewallet https://elmi.hbku.edu.qa/en/publications/a-large-scale-study-and-classification-of-virustotal-reports-on-p/ A Large Scale Study and Classification of VirusTotal Reports on Phishing and Malware URLs - Hamad... large scalevirustotal reportsstudyclassificationphishing https://itbrief.asia/story/two-step-phishing-attacks-cyber-espionage-increasing Two-step phishing attacks, cyber-espionage increasing Cybercrime has become the world's third largest economy, and estimated to generate $8 trillion by the end of 2023. two stepphishing attackscyber espionageincreasing https://www.docusign.com/trust/alerts/update-7-16-2018-8-33-am-pacific-time-new-phishing-campaign-observed ALERT:7/16/2018 @ 8:33 AM Pacific Time - New Phishing Campaign Observed pacific timealertnewphishingcampaign https://anteelo.com/10-ways-to-prevent-phishing-attack-in-2020/ Ways of Averting Phishing Attack - Anteelo Design Private Limited Jun 3, 2021 - Phishing attack is basically the most common but dangerous cyber-attack vector that is capable of exploiting the entire data of an... phishing attackwaysdesignprivatelimited https://blog.start-software.com/2020/12/gone-phishing-what-to-do-when-you-get.html Gone Phishing? What to do when you get a dodgy email Start Software blog: news and updates on Alpha Tracker, Alpha Legal, ecoScribe and our specialist software development services what to dogonephishinggetdodgy https://www.anomali.com/blog/anomali-cyber-watch-remcos-rat-bitb-phishing-linux-malware-framework-supply-chain-intrusion-and-more Anomali Cyber Watch: Remcos RAT, BitB phishing, Linux Malware Framework, Supply Chain Intrusion and... New Malware Campaign Delivers Remcos RAT Through Text-Only Staging and Living-Off-the-Land Execution. Browser-in-the-Browser Phishing Evolves into a... supply chainanomalicyberwatchrat https://www.brighthub.com/computing/windows-platform/articles/4781/ How Phishing happens: Know Your Enemy (Man in the Middle Attacks) Man In the Middle (MITM) attacks are increasingly prevalent now, and this form of attack makes use of ways not immediately obvious. One of the most used forms... know your enemyin the middlephishinghappensman https://andysowards.com/blog/tag/phishing/ phishing Archives - Daily Business Resources for Entrepreneurs, Web Designers, & Creatives by Andy... resources for entrepreneursarchives dailyweb designersphishingbusiness https://the420.in/fake-party-invitation-phishing-scam/ New Phishing Scam Uses Fake Party Invites To Steal Passwords And Personal Data - The420.in May 4, 2026 - A new phishing scam uses fake party invitations and compromised email accounts to steal passwords, personal data and access to online accounts. phishing scamparty invitespersonal datanewuses https://teufelswerk.net/tag/phishing-kit/ Phishing-Kit | teufelswerk | IT-Sicherheit & Cybersecurity phishing kitsicherheitcybersecurity https://community.avast.com/t/new-kind-of-phishing/693924 new kind of PHISHING? - Viruses and worms - Avast Community Feb 2, 2014 - Hi Guys, I would like to know the REASONS / CAUSES why I am being redirected to another website when I log on to an ONLINE BANKING website. The following are... viruses and wormskind ofnewphishingavast https://hackerjournal.it/8752/campagna-sms-phishing-clonazione-del-green-pass/ Segnalata campagna SMS phishing Green Pass | Hackerjournal.it sms phishinggreen passcampagna https://www2.telenet.be/residential/nl/klantenservice/internet/veilig-surfen/phishing-hacking-melden Phishing of hacking, wat nu? | MyTelenet phishinghackingwatnumytelenet https://www.footprint.co.uk/security/gone-phishing/ Gone Phishing? - Footprint Digital Mar 9, 2015 - Being proactive with on-line security has always been important but with website attacks increasing in frequency, taking steps to safeguard your website should... gonephishingfootprintdigital https://blog.polyswarm.io/tag/phishing-campaign Insights, news, education and announcements from PolySwarm | Phishing Campaign Phishing Campaign | Analyze suspicious files and URLs, at scale, millions of times per day. Get real-time threat intel from a crowdsourced network of security... insights newseducationannouncementsphishingcampaign https://www.zscaler.com/blogs/security-research/spear-phishing-campaign-delivers-buer-and-bazar-malware Spear Phishing Campaign Delivers Buer & Bazar | Zscaler Blog Be attentive while opening any email. The Zscaler research team became aware of a prevalent phishing campaign targeting employees of various organizations. spear phishingcampaigndeliversbuerbazar https://heimdalsecurity.com/blog/fan-courier-phishing/ SECURITY ALERT: Newly Discovered Fan Courier Phishing Campaign Targets Romanian Companies Feb 19, 2021 - New Fan Courier phishing campaign discovered in the wild. Click here to read more about this newly-detected malicious endeavor. security alertnewly discoveredfan courierphishingcampaign https://www.exclusive-networks.com/ie/resources/knowledge-base/glossary/phishing What is Phishing? | Cybersecurity Glossary Discover phishing techniques and how to identify and protect against these attacks. what is phishingcybersecurity glossary https://ideakiln.com/ideas/eleidon Eleidon - Productivity Launched | phishing-proof messaging,s | Idea Kiln phishing-proof messaging,secure messaging,anti-phishing app,verified senders,end-to-end encryption,e - Productivity Launched. Built by James. productivitylaunchedphishingproofmessaging https://kbookmarking.com/story19916074/the-electronic-arms-race-unmasking-phishing-with-ai-and-device-mastering The Electronic Arms Race: Unmasking Phishing with AI and Device Mastering arms raceelectronicunmaskingphishingai https://www.proofpoint.com/us/customer-stories/university-oklahoma-controls-phishing-attacks The University of Oklahoma Controls Phishing Attacks with Proofpoint | Proofpoint US university of oklahomaphishing attackscontrolsproofpointus https://www.sfu.ca/information-systems/announcements-alerts/security-alerts/phishing-scams-sfu-mail.html Phishing scams circulating SFU email account holders - Information Systems at SFU - Simon Fraser... phishing scamsemail accountinformation systemssimon frasersfu https://www.visualistan.com/search/label/Phishing?max-results=12 Visualistan: Phishing visualistanphishing https://www.f5.com/labs/articles/phishing-for-information-part-4-beware-of-data-leaking-out-of-your-equipment Phishing for Information, Part 4: Beware of Data Leaking Out of Your Equipment | F5 Labs Organizations often overlook the many ways in which their own systems put useful information right into the hands of attackers building cyber scams. for informationyour equipmentphishingpartbeware https://www.webtechcrunch.com/tag/phishing/ phishing Archives - WebTechCrunch phishingarchives https://cyberwarriorsmiddleeast.com/phishing-attack-successfully-evades-fido-key-security/ Phishing Attack Successfully Evades FIDO Key Security - Cyber Warriors Middle East Jul 21, 2025 - A recent discovery by a managed detection and response (MDR) provider has unveiled a phishing campaign that effectively bypasses FIDO key authentication. This phishing attackcyber warriorsmiddle eastsuccessfullyfido https://www.activerain.com/questions/show/67379/have-you-experienced-phishing-in-real-estate- Have you experienced phishing in real estate? ActiveRain is an online community of real estate professionals who write blogs, exchange best practices and share information. Welcome to the neighborhood. real estateexperiencedphishing https://www.paubox.com/blog/phishing-ploy-targets-covid-19-vaccine-distribution Phishing ploy targets COVID-19 vaccine distribution IBM security researchers have discovered an email phishing campaign targeted at companies involved with the cold chain distribution of the COVID-19 vaccine vaccine distributionphishingtargetscovid https://www.nextgov.com/cybersecurity/2024/12/lawmakers-targeted-encrypted-messaging-phishing-scam/401499/?oref=ng-author-river Lawmakers targeted in encrypted messaging phishing scam - Nextgov/FCW Officials have been urging Americans and federal staff to pivot to encrypted messaging services amid a recent Chinese breach into telecommunications net... encrypted messagingphishing scamlawmakerstargetedfcw