https://stake-fr.com/
Suspected Phishing | Cloudflare
suspectedphishingcloudflare
https://openphish.com/
OpenPhish - Phishing Intelligence
OpenPhish provides actionable intelligence data on active phishing threats.
phishing intelligence
https://phishingquiz.withgoogle.com/
Jigsaw | Phishing Quiz
Can you spot when you're being phished?
phishing quizjigsaw
https://impressions.manipal.edu/open-access-archive/14154/
"Enhancing Phishing Detection: A Machine Learning Approach With Feature" by Ganesh S. Nayak,...
With the rise in cybercrime, phishing remains a significant concern as it targets individuals with fake websites, causing victims to disclose their private...
phishing detectiona machinelearning approachenhancingfeature
https://www.westjet.com/en-ca/news/2021/westjet-warns-public-of-new-phishing-email-scams
WestJet warns public of new phishing email scams
WestJet is warning the public of new email scams using the WestJet name and brand likeness combined with a time-sensitive discount voucher to get recipients to...
phishing emailwestjetwarnspublicnew
https://antiphishing.biz/2025/07/26/united-overseas-bank-limited-uob-phishing-page-revealed/
United Overseas Bank Limited (UOB) phishing page revealed - Antiphishing.biz
Apr 1, 2026 - A high-fidelity phishing campaign targeting United Overseas Bank (UOB) users in Southeast Asia utilizes fraudulent SMS and email links to harvest login...
united overseas banklimiteduobphishingrevealed
https://learn.microsoft.com/en-us/microsoft-365/admin/security-and-compliance/m365b-users-phishing-spam-malware?view=o365-worldwide
Protect users against phishing and other attacks - Microsoft 365 admin | Microsoft Learn
Protect against phishing and other attacks with Microsoft 365 Business Premium.
protectusersphishingattacksmicrosoft
https://www.lbcc.edu/phishing
Phishing - Long Beach City College
Office of Information Security
long beachcity collegephishing
https://phish.report/IOK/indicators/smbc-9776441
SMBC Phishing Kit 9776441 - phish.report
Detects a SMBC phishing kit targeting Japanese users.
phishing kitsmbcreport
https://fakeinet.com/clothingnfashion-ru-tienda-online-dudosa-parfois/
clothingnfashion.ru tienda online dudosa Parfois - Fakes, tiendas dudosas, phishing...
Aug 15, 2022 - clothingnfashion.ru es una tienda online dudosa de productos de Parfois. Muchos descuentos pero mejor lee esto antes de comprar.
tienda onlineruparfoisfakestiendas
https://westoba.com/news/collabria-alert-potential-phishing-site/
Collabria Alert: Potential Phishing Site - Westoba
collabriaalertpotentialphishingsite
https://jateng.antaranews.com/berita/528624/waspadai-modus-pencurian-data-priibadi-melalui-phishing
Waspadai modus pencurian data priibadi melalui phishing - ANTARA News Jateng
Modus pencurian data pribadi melalui phishing adalah kejahatan dunia digital yang berbahaya dan akhir-akhir ini marak terjadi melalui media sosial, salah...
antara newsmoduspencuriandataphishing
https://www.govtech.com/security/phishing-remains-persistent-threat-in-k-12-cybersecurity
Phishing Remains Persistent Threat in K-12 Cybersecurity
Sep 23, 2025 - The education sector has seen a swift rise in cybersecurity incidents since 2024, but training, awareness and tools can help ease incidents and response time.
phishingremainspersistentthreatk
https://www.exploitone.com/mobile-security/hackers-steal-facebook-messenger-login-credentials-via-massive-phishing-campaign/
Hackers steal Facebook Messenger login credentials via massive phishing campaign
Apr 20, 2021 - Hackers steal Facebook Messenger login credentials via massive phishing campaign - Mobile Security Cyber Security News | Exploit One | Hacking News
facebook messengerlogin credentialshackersstealvia
https://www.a-i3.org/2017/12/ganz-und-gar-nicht-sicher-immer-mehr-phishing-webseiten-setzen-auf-https/
Ganz und gar nicht sicher: Immer mehr Phishing-Webseiten setzen auf HTTPS | a-i3.org
ganzundgarnichtsicher
https://indico.global/event/14045/page/4940-warning-phishing-global-travel-experts
2nd AstroORDAS Workshop and ACME WP4 meeting (8-December 12, 2025): Warning: Phishing Global Travel...
WARNING: phishing attempts from Global Travel Experts (more info here) We would like to announce a week-long workshop on online research data analysis services...
global travelworkshopacmemeetingdecember
https://isc.sans.edu/diary/28984
Paypal Phishing/Coinbase in One Image - SANS ISC
Paypal Phishing/Coinbase in One Image, Author: Xavier Mertens
one imagesans iscpaypalphishingcoinbase
https://thecentexitguy.com/phishing-3-0-sophisticated-social-engineering-in-the-enterprise/
Phishing 3.0: Sophisticated Social Engineering in the Enterprise
Aug 29, 2025 - Phishing 3.0 is reshaping enterprise threats with AI-driven tactics and advanced social engineering. Learn how attackers exploit trust, and what defenses...
in the enterprisesocial engineeringphishingsophisticated
https://developer.nvidia.com/blog/designing-a-new-net-for-phishing-detection-with-nvidia-morpheus/
Designing a New Net for Phishing Detection with NVIDIA Morpheus | NVIDIA Technical Blog
Jun 2, 2022 - With NVIDIA Morpheus, now available for download, you can achieve up to 99% accuracy for phishing detection, using AI.
phishing detectiontechnical blogdesigningnewnvidia
https://www.datamation.com/security/online-phishing-scams-exploding/
Online Phishing Scams Exploding | Datamation
Jan 28, 2021 - Identity theft has taken a bad turn with the number of phishing scams increasing nearly 800-fold over the last 10 months. Last September, there were 279
phishing scamsonlineexplodingdatamation
https://ijarcce.com/papers/phishing-websites-prediction-based-on-artificial-neural-network-technique/
Phishing Websites Prediction based on Artificial Neural Network Technique | Peer-reviewed Journal
Abstract- Phishing attacks have emerged as a significant threat to online security, targeting unsuspecting users to divulge sensitive information through...
artificial neural networkpeer reviewed journalbased onphishingwebsites
https://www.cybersecurityup.it/knowledge-hub/news/cyber-attacchi-xdspy-phishing-e-malware-sconvolgono-russia-e-moldova
Cyber Attacchi XDSpy: Phishing e Malware Sconvolgono Russia e Moldova
Un gruppo di cyber spionaggio poco conosciuto, denominato XDSpy, ha recentemente preso di mira aziende in Russia e Moldova attraverso una...
cyberattacchiphishingmalwarerussia
https://uctechnews.ucop.edu/tag/phishing/
Phishing | UC Tech News
tech newsphishinguc
https://www.tectack.org/2026/02/tenga-confirms-customer-data-spill.html
TENGA Confirms Customer Data Spill After Phishing Compromised an Employee Inbox
TENGA Confirms Customer Data Spill After Phishing Compromised an Employee Inbox
customer dataan employeetengaspillphishing
https://phishdestroy.io/ru/domain/profitabletrade.xyz/
profitabletrade.xyz Phishing Attempt Shut Down Quickly
May 13, 2026 - profitabletrade.xyz was a low-risk phishing site now offline. Avoid sharing personal info or credentials w... Site title: "Profitable Trade Digital Ce...".
shut downxyzphishingattemptquickly
https://gulfpress.net/uae-more-than-50-of-residents-are-victims-of-phishing-sites-nearly-20-targeted-by-social-media-scams/
UAE: More than 50% of residents are victims of phishing sites, nearly 20% targeted by social media...
May 20, 2024 - The UAE Cyber Security Council recently reported that a significant number of individuals and businesses fell victim to cyber attacks in the third quarter
more thansocial mediauaeresidentsvictims
https://www.teamviewer.com/apac/insights/it-news-research-roundup-floppy-discs-phishing/
Floppy discs, vague tickets, and phishing training | TeamViewer
Dec 17, 2025 - Read on to learn why Cambridge library technicians care so much about the humble floppy. But first, a handful of fascinating IT news and research items from...
floppy discsphishing trainingvagueticketsteamviewer
https://blog.knowbe4.com/uk-national-lottery-hacked-watch-out-for-phishing-attacks-on-millions-of-customers
UK National Lottery hacked: Watch Out For Phishing Attacks On Millions Of Customers
UK National Lottery hacked: Watch Out For Phishing Attacks On Millions Of Customers
uk national lotterywatch outphishing attackshackedmillions
https://www.megaupdate24.com/tag/best-phishing-simulation/
Best Phishing Simulation
phishing simulationbest
https://www.syschat.com/gmail-users-warned-new-phishing-scheme-1009.html
Gmail users warned of new phishing scheme - SysChat
Gmail users warned of new phishing scheme News
gmailuserswarnednewphishing
https://www.dbdigest.com/2020/10/phishing-45-of-global-remote-workers.html
Data Breaches Digest: Phishing: 45% Of Global Remote Workers Ignore Training And Open Emails They...
Daily Digest of Global Data Breaches and Cyber Security News and Advice
data breachesremote workersdigestphishingglobal
https://www.hklaw.com/en/events/2019/11/business-email-compromise-and-phishing-prevention-and-response
Business Email Compromise and Phishing: Prevention and Response for Lawyers | Events | Holland &...
In a one-hour briefing webinar for PLI, Cybersecurity, Data Privacy and Intellectual Property Attorney Mark Francis will provide key takeaways from recent...
business email compromisephishing preventionfor lawyersresponseevents
https://www.computerweekly.com/news/252484788/Check-Point-uncovers-targeted-Microsoft-Office-365-phishing-campaign?_gl=1*144lcee*_ga*MjUxNTM0Mzg0LjE2MzAwMDgxNjE.*_ga_TQKE4GS5P9*MTYzMDAwODE2MS4xLjEuMTYzMDAwODE4NS4w&_ga=2.23536826.1008818071.1629842553-68222631.1628548745
Check Point uncovers targeted Microsoft Office 365 phishing campaign | Computer Weekly
Organised criminal campaign exploited Adobe, Oxford University and Samsung web domains to trick users into giving up their passwords
check pointmicrosoft officecomputer weeklytargetedphishing
https://scampolicegroup.com/romance-scam-advance-fee-fraud-phishing-david-hudson/
Romance Scam/Advance Fee Fraud/Phishing: DAVID HUDSON - Scampolice Group
May 20, 2019 - Romance scammer DAVID HUDSON is using stolen photos of a decent person which are commonly seen and abused. Read other posts on our website and also the...
advance fee fraudromance scamdavid hudsonphishinggroup
https://www.windowsobserver.com/2011/02/27/unique-phishing-by-email-attempt/
Unique Phishing By Email Attempt | WindowsObserver.com
by emailuniquephishingattempt
https://cybersecurityminute.com/human-factors-in-cybersecurity/germany-probes-russia-linked-signal-phishing-of-officials/
Germany Probes Russia-Linked Signal Phishing of Officials | CyberSecurity Minute
Apr 27, 2026 - A single QR code, framed as emergency support inside a trusted app, quietly unlocked weeks of sensitive conversation as German federal prosecutors opened an...
germanyprobesrussialinkedsignal
https://classiccmp.org/pipermail/cctalk/2022-April/063359.html
phishing increase lately
phishingincreaselately
https://www.bvmw.de/de/internet-und-digitalisierung/checkliste-phishing-mails-erkennen-und-richtig-handeln?x-craft-live-preview=1ebf05fa46447c0514981d2b3bbc77c3ee75b771812841874620bf3e72619f41jrzkndcabr
Checkliste: Phishing-Mails erkennen und richtig handeln - BVMW DE
Erfahren Sie in unserer Checkliste, wie Sie und Ihre Mitarbeitenden Phishing-E-Mails erkennen und wie Sie im Verdachtsfall umgehen sollten?
phishing mailschecklisteerkennenundrichtig
https://www.ndss-symposium.org/ndss-paper/auto-draft-508/
Exploring Phishing Threats through QR Codes in Naturalistic Settings - NDSS Symposium
phishing threatsqr codesexploringnaturalisticsettings
https://www.lowyat.net/2017/130859/google-shuts-massive-google-docs-phishing-campaign/
Google Shuts Down Massive Google Docs Phishing Campaign - Lowyat.NET
May 4, 2017 - A phishing scam using an elaborate facsimile of Google Docs has been shut down.
googlemassivedocsphishingcampaign
https://www.onlinethreatalerts.com/article/2019/10/6/usaa-bank-policy-updates-phishing-scam/
USAA Bank Policy Updates Phishing Scam
The email message below with the subject Notice of Policy Updates, was NOT sent by USAA. The phishing ema...
usaa bankpolicy updatesphishing scam
https://www.privacy.com.sg/resources/phishing-emails/
The Menace of Phishing Emails and How to Stay Secure - Privacy Ninja
Nov 9, 2023 - Stay informed about Phishing Emails and know how to stay secure.
how to stayphishing emailsmenacesecureprivacy
https://www.altusintel.com/public-yychwm/
Tycoon2fa Elevates Phishing, Renders Security Useless | Altus Intel
Apr 13, 2025 - Important Updates in Tycoon2FA Phishing Platform Developers of the Tycoon2FA phishing platform have made significant advancements in bypassing
phishingrenderssecurityuselessaltus
https://internationalbusinessweekly.com/phishing-for-trouble-the-returning-physical-bank-token-is-no-silver-bullet/
Phishing for trouble: The returning physical bank token is no silver bullet - International...
Nov 7, 2025 - Latest effort to counter phishing could rattle less-tech-savvy customers. It also needs a digital ecosystem to work
silver bulletphishingtroublereturningphysical
https://www.bipprime.net/avoiding-phishing-while-downloading-mp3s
Avoiding Phishing While Downloading MP3s - Bip Prime
Searching for the best download youtube MP3 and download youtube MP4 downloader to switch your number one recordings over completely to MP3? Look no further!...
avoidingphishingdownloadingbipprime
https://www.cafepress.com/+cybersecurity_0_days_without_an_incident_phishing_shower_curtain,1204881478
Cybersecurity 0 Days Without An Incident Phishing Shower Curtain | CafePress
Shop Cybersecurity 0 Days Without An Incident Phishing Shower Curtain designed by T-Shirt.CONCEPTS. Lots of different size and color combinations to choose...
an incidentshower curtaincybersecuritydayswithout
https://mindmatters.ai/t/phishing/
Tag: Phishing | Mind Matters
Tag: Phishing, at Mind Matters
mind matterstagphishing
https://wcoinsw.com/crypto/google-ads-data-4m-stolen-through-crypto-phishing-urls/
Google Ads data: $4M stolen through crypto phishing URLs - Wild Coins World
Apr 27, 2023 - Data from Google Ads coupled with blockchain analytics reveals that over $4 million has been stolen from users that have fallen for malicious phishing websites...
google adswild coinsdatastolencrypto
https://radar.avrotros.nl/artikel/honderden-phishing-sites-iedere-maand-offline-16836
Honderden phishing-sites iedere maand offline | Radar
Aug 23, 2015 - Nederlandse banken hebben hostingproviders dit jaar gemiddeld 470 keer per maand gevraagd een phishing-website offline te halen. Criminelen proberen via deze...
phishingsitesiederemaandoffline
https://www.kaspersky.de/blog/hacked-routers-dns-hijacking/19078/
Angreifer hacken Router, um Nutzer auf Phishing-Seiten umzuleiten | Offizieller Blog von Kaspersky
Angreifer hacken Heimrouter, modifizieren ihre Einstellungen und leiten Nutzer unbemerkt auf Phishing-Seiten weiter, um Ihre Anmeldedaten zu stehlen.
hackenrouterumnutzerauf
https://research.splunk.com/endpoint/2fa9dec8-9d8e-46d3-96c1-202c06f0e6e1/
Detection: Windows Phishing PDF File Executes URL Link | Splunk Security Content
Apr 15, 2026 - Updated Date: 2026-04-15 ID: 2fa9dec8-9d8e-46d3-96c1-202c06f0e6e1 Author: Teoderick Contreras, Splunk Type: Anomaly Product: Splunk Enterprise Security...
pdf fileurl linkdetectionwindowsphishing
https://nquiringminds.com/cybernews-summaries/4ac9c40a9b9f3b0cecd99858da84f387/
Ongoing Phishing Campaign Targets Senior Corporate Accounts in Microsoft Azure Environments |...
corporate accountsmicrosoft azureongoingphishingcampaign
https://www.info.gov.hk/gia/general/202412/24/P2024122400339.htm
Phishing instant messages related to Bank of China (Hong Kong) Limited
The following is issued on behalf of the Hong Kong Monetary Authority: The Hong Kong Monetary Authority (HKMA) wishes to alert members of the public to a press...
bank of chinainstant messagesrelated tohong kongphishing
https://thehackernews.com/2024/09/say-goodbye-to-phishing-must-haves-to.html?version=meter+at+null
Say Goodbye to Phishing: Must-Haves to Eliminate Credential Theft
Discover how Beyond Identity's deterministic security approach eliminates phishing, credential theft, and other cyber threats with passwordless, phish
say goodbyemust havescredential theftphishingeliminate
https://www.analyticsinsight.net/news/pi-network-phishing-alert-only-use-walletpinet-announces-core-team
Pi Network Phishing Alert: Only Use wallet.pi.net, Announces Core Team
Pi Network warns users about fake wallet phishing scams. Learn how to identify real Pi Wallet links and protect your crypto during Open Mainnet.
pi networkphishing alertcore teamusewallet
https://elmi.hbku.edu.qa/en/publications/a-large-scale-study-and-classification-of-virustotal-reports-on-p/
A Large Scale Study and Classification of VirusTotal Reports on Phishing and Malware URLs - Hamad...
large scalevirustotal reportsstudyclassificationphishing
https://itbrief.asia/story/two-step-phishing-attacks-cyber-espionage-increasing
Two-step phishing attacks, cyber-espionage increasing
Cybercrime has become the world's third largest economy, and estimated to generate $8 trillion by the end of 2023.
two stepphishing attackscyber espionageincreasing
https://www.docusign.com/trust/alerts/update-7-16-2018-8-33-am-pacific-time-new-phishing-campaign-observed
ALERT:7/16/2018 @ 8:33 AM Pacific Time - New Phishing Campaign Observed
pacific timealertnewphishingcampaign
https://anteelo.com/10-ways-to-prevent-phishing-attack-in-2020/
Ways of Averting Phishing Attack - Anteelo Design Private Limited
Jun 3, 2021 - Phishing attack is basically the most common but dangerous cyber-attack vector that is capable of exploiting the entire data of an...
phishing attackwaysdesignprivatelimited
https://blog.start-software.com/2020/12/gone-phishing-what-to-do-when-you-get.html
Gone Phishing? What to do when you get a dodgy email
Start Software blog: news and updates on Alpha Tracker, Alpha Legal, ecoScribe and our specialist software development services
what to dogonephishinggetdodgy
https://www.anomali.com/blog/anomali-cyber-watch-remcos-rat-bitb-phishing-linux-malware-framework-supply-chain-intrusion-and-more
Anomali Cyber Watch: Remcos RAT, BitB phishing, Linux Malware Framework, Supply Chain Intrusion and...
New Malware Campaign Delivers Remcos RAT Through Text-Only Staging and Living-Off-the-Land Execution. Browser-in-the-Browser Phishing Evolves into a...
supply chainanomalicyberwatchrat
https://www.brighthub.com/computing/windows-platform/articles/4781/
How Phishing happens: Know Your Enemy (Man in the Middle Attacks)
Man In the Middle (MITM) attacks are increasingly prevalent now, and this form of attack makes use of ways not immediately obvious. One of the most used forms...
know your enemyin the middlephishinghappensman
https://andysowards.com/blog/tag/phishing/
phishing Archives - Daily Business Resources for Entrepreneurs, Web Designers, & Creatives by Andy...
resources for entrepreneursarchives dailyweb designersphishingbusiness
https://the420.in/fake-party-invitation-phishing-scam/
New Phishing Scam Uses Fake Party Invites To Steal Passwords And Personal Data - The420.in
May 4, 2026 - A new phishing scam uses fake party invitations and compromised email accounts to steal passwords, personal data and access to online accounts.
phishing scamparty invitespersonal datanewuses
https://teufelswerk.net/tag/phishing-kit/
Phishing-Kit | teufelswerk | IT-Sicherheit & Cybersecurity
phishing kitsicherheitcybersecurity
https://community.avast.com/t/new-kind-of-phishing/693924
new kind of PHISHING? - Viruses and worms - Avast Community
Feb 2, 2014 - Hi Guys, I would like to know the REASONS / CAUSES why I am being redirected to another website when I log on to an ONLINE BANKING website. The following are...
viruses and wormskind ofnewphishingavast
https://hackerjournal.it/8752/campagna-sms-phishing-clonazione-del-green-pass/
Segnalata campagna SMS phishing Green Pass | Hackerjournal.it
sms phishinggreen passcampagna
https://www2.telenet.be/residential/nl/klantenservice/internet/veilig-surfen/phishing-hacking-melden
Phishing of hacking, wat nu? | MyTelenet
phishinghackingwatnumytelenet
https://www.footprint.co.uk/security/gone-phishing/
Gone Phishing? - Footprint Digital
Mar 9, 2015 - Being proactive with on-line security has always been important but with website attacks increasing in frequency, taking steps to safeguard your website should...
gonephishingfootprintdigital
https://blog.polyswarm.io/tag/phishing-campaign
Insights, news, education and announcements from PolySwarm | Phishing Campaign
Phishing Campaign | Analyze suspicious files and URLs, at scale, millions of times per day. Get real-time threat intel from a crowdsourced network of security...
insights newseducationannouncementsphishingcampaign
https://www.zscaler.com/blogs/security-research/spear-phishing-campaign-delivers-buer-and-bazar-malware
Spear Phishing Campaign Delivers Buer & Bazar | Zscaler Blog
Be attentive while opening any email. The Zscaler research team became aware of a prevalent phishing campaign targeting employees of various organizations.
spear phishingcampaigndeliversbuerbazar
https://heimdalsecurity.com/blog/fan-courier-phishing/
SECURITY ALERT: Newly Discovered Fan Courier Phishing Campaign Targets Romanian Companies
Feb 19, 2021 - New Fan Courier phishing campaign discovered in the wild. Click here to read more about this newly-detected malicious endeavor.
security alertnewly discoveredfan courierphishingcampaign
https://www.exclusive-networks.com/ie/resources/knowledge-base/glossary/phishing
What is Phishing? | Cybersecurity Glossary
Discover phishing techniques and how to identify and protect against these attacks.
what is phishingcybersecurity glossary
https://ideakiln.com/ideas/eleidon
Eleidon - Productivity Launched | phishing-proof messaging,s | Idea Kiln
phishing-proof messaging,secure messaging,anti-phishing app,verified senders,end-to-end encryption,e - Productivity Launched. Built by James.
productivitylaunchedphishingproofmessaging
https://kbookmarking.com/story19916074/the-electronic-arms-race-unmasking-phishing-with-ai-and-device-mastering
The Electronic Arms Race: Unmasking Phishing with AI and Device Mastering
arms raceelectronicunmaskingphishingai
https://www.proofpoint.com/us/customer-stories/university-oklahoma-controls-phishing-attacks
The University of Oklahoma Controls Phishing Attacks with Proofpoint | Proofpoint US
university of oklahomaphishing attackscontrolsproofpointus
https://www.sfu.ca/information-systems/announcements-alerts/security-alerts/phishing-scams-sfu-mail.html
Phishing scams circulating SFU email account holders - Information Systems at SFU - Simon Fraser...
phishing scamsemail accountinformation systemssimon frasersfu
https://www.visualistan.com/search/label/Phishing?max-results=12
Visualistan: Phishing
visualistanphishing
https://www.f5.com/labs/articles/phishing-for-information-part-4-beware-of-data-leaking-out-of-your-equipment
Phishing for Information, Part 4: Beware of Data Leaking Out of Your Equipment | F5 Labs
Organizations often overlook the many ways in which their own systems put useful information right into the hands of attackers building cyber scams.
for informationyour equipmentphishingpartbeware
https://www.webtechcrunch.com/tag/phishing/
phishing Archives - WebTechCrunch
phishingarchives
https://cyberwarriorsmiddleeast.com/phishing-attack-successfully-evades-fido-key-security/
Phishing Attack Successfully Evades FIDO Key Security - Cyber Warriors Middle East
Jul 21, 2025 - A recent discovery by a managed detection and response (MDR) provider has unveiled a phishing campaign that effectively bypasses FIDO key authentication. This
phishing attackcyber warriorsmiddle eastsuccessfullyfido
https://www.activerain.com/questions/show/67379/have-you-experienced-phishing-in-real-estate-
Have you experienced phishing in real estate?
ActiveRain is an online community of real estate professionals who write blogs, exchange best practices and share information. Welcome to the neighborhood.
real estateexperiencedphishing
https://www.paubox.com/blog/phishing-ploy-targets-covid-19-vaccine-distribution
Phishing ploy targets COVID-19 vaccine distribution
IBM security researchers have discovered an email phishing campaign targeted at companies involved with the cold chain distribution of the COVID-19 vaccine
vaccine distributionphishingtargetscovid
https://www.nextgov.com/cybersecurity/2024/12/lawmakers-targeted-encrypted-messaging-phishing-scam/401499/?oref=ng-author-river
Lawmakers targeted in encrypted messaging phishing scam - Nextgov/FCW
Officials have been urging Americans and federal staff to pivot to encrypted messaging services amid a recent Chinese breach into telecommunications net...
encrypted messagingphishing scamlawmakerstargetedfcw