Robuta

https://anteelo.com/10-ways-to-prevent-phishing-attack-in-2020/ Ways of Averting Phishing Attack - Anteelo Design Private Limited Jun 3, 2021 - Phishing attack is basically the most common but dangerous cyber-attack vector that is capable of exploiting the entire data of an... phishing attackwaysdesignprivatelimited https://thehackernews.com/2017/01/gmail-phishing-page.html Don't Fall For This Dangerously Convincing Ongoing Phishing Attack Beware, Don't fall for this Convincing Gmail Phishing Scam. phishing attackfalldangerouslyconvincingongoing https://cyberwarriorsmiddleeast.com/phishing-attack-successfully-evades-fido-key-security/ Phishing Attack Successfully Evades FIDO Key Security - Cyber Warriors Middle East Jul 21, 2025 - A recent discovery by a managed detection and response (MDR) provider has unveiled a phishing campaign that effectively bypasses FIDO key authentication. This phishing attackcyber warriorsmiddle eastsuccessfullyfido https://www.itpro.com/security/phishing/361042/hackers-spoof-zix-in-credential-phishing-attack Hackers spoof Zix in credential phishing attack | IT Pro Sep 28, 2021 - The attack has impacted around 75,000 Office 365, Google Workspace and Exchange users phishing attackit prohackersspoofcredential https://aviatrix.ai/threat-research-center/obfuscated-javascript-phishing-attack-april-2026/ Obfuscated JavaScript Phishing Attack Delivers FormBook Malware - April 2026 In April 2026, a sophisticated phishing campaign used obfuscated JavaScript to deliver FormBook malware, evading detection through multi-stage payloads and... obfuscated javascriptphishing attackdeliversmalwareapril https://www.digitalinformationworld.com/2021/06/hackers-are-using-google-docs-as.html Hackers Are Using Google Docs As A Platform For Yet Another Dangerous Phishing Attack Here's how Google Docs is being utilized as a tool for spearheading phishing attacks against other members of the community. google docsas ayet anotherphishing attackhackers https://blog.knowbe4.com/dns-hijacking-almost-always-starts-with-a-successful-spear-phishing-attack DNS Hijacking Almost Always Starts With A Successful Spear Phishing Attack DNS Hijacking Almost Always Starts With A Successful Spear Phishing Attack dns hijackingalmost alwaysstarts withspear phishingsuccessful https://www.indiablooms.com/life/35000-users-hacked-microsoft-reveals-massive-global-phishing-attack/details 35,000 users hacked? Microsoft reveals massive global phishing attack | Indiablooms - First Portal... May 6, 2026 - Microsoft has uncovered a massive global phishing campaign targeting over 35,000 users across 13,000 organisations in 26 countries. | One of India's leading... phishing attackusershackedmicrosoftreveals https://www.verdict.co.uk/walkme-files-patent-for-the-patent-is-filed-for-a-method-to-detect-phishing-attacks/ WalkMe Ltd Files Patent for Phishing Attack Detection Method Nov 28, 2023 - Detect and respond to phishing attacks with a patented method. Analyze visual similarity between source and target pages to classify attacks and take... phishing attackwalkmeltdfilespatent https://www.trendmicro.com/vinfo/us/security/news/cybercrime-and-digital-threats/seagate-employees-face-possible-tax-fraud-in-recent-phishing-attack Seagate Employees Face Possible Tax Fraud in Recent Phishing Attack | Trend Micro (US) Storage device manufacturing company Seagate, announced a successful phishing attack that placed a number of present and former employees at risk of potential... tax fraudphishing attacktrend microseagateemployees https://protos.com/phishing-attack-on-software-firm-retool-enabled-fortress-trust-hack-coindesk/ Phishing attack on software firm Retool enabled Fortress Trust hack: CoinDesk Sep 14, 2023 - Fortress Trust claimed no funds were lost following a $15M crypto hack now revealed by CoinDesk to have occurred through Retool. phishing attackon softwarefirmretoolenabled https://www.stimulustech.com/2022/11/07/dropbox-suffers-major-breach-in-phishing-attack/ Dropbox Suffers Major Breach in Phishing Attack - Stimulus Technologies Nov 7, 2022 - It's no secret that cyber attacks are on the rise, and that no company is immune to them. Dropbox, a cloud storage company, was the lastest victim when their... phishing attackdropboxmajorbreachstimulus https://www.techathand.net/tips-and-tricks/phishing-attack-using-paypal/314/ Phishing Attack using PayPal - Tech At Hand Dot Net Oct 20, 2016 - I just received a unique PayPal Scam. This is the firs time I receive such kind of email. And after checking the links of the [more...] phishing attackdot netusingpaypaltech https://bitday.net/major-phishing-attack-on-venus-protocol-results-in-27-million-loss/ Venus Protocol Phishing Attack Sep 3, 2025 - Venus Protocol suffers $27M loss due to a large-scale phishing attack; security review underway. phishing attackvenusprotocol https://www.technologistan.pk/hacker-steals-1-7-million-worth-of-nfts-from-opensea-users/ OpenSea Loses$1.7 Million in NFTs in Phishing Attack Feb 21, 2022 - Technologistan is a technology media platform, dedicated to the coverage of news from different regions with a special focus on Pakistan. phishing attackopensealosesmillionnfts https://www.lobstersauce.news/p/phishing-attack-targets-openclaw-developers-via-github Phishing attack targets OpenClaw developers via GitHub | lobstersauce.news A recent phishing attack has targeted OpenClaw developers via GitHub, as reported by OX Security. The attackers have been creating fake accounts and posting fra phishing attackvia githubtargetsopenclawdevelopers https://2wtech.com/new-phishing-attack-is-hitting-office-365-accounts/ New Phishing Attack is Hitting Office 365 Accounts - 2WTech Dec 24, 2018 - This phishing attack steals Microsoft account credentials by sending out emails that look like email non-delivery notifications from Office 365. phishing attacknewhittingofficeaccounts https://www.veracode.com/blog/ledger-phishing-attack-connect-kit/ Ledger npm Repo Breached in Spear Phishing Attack | Veracode Jun 4, 2025 - Application Security for the AI Era | Veracode spear phishingledgernpmrepoattack https://umdloti.org/article/microsoft-exposes-massive-phishing-attack-how-to-protect-your-organization-in-2026 Microsoft Exposes Massive Phishing Attack: How to Protect Your Organization in 2026 (2026) May 17, 2026 - Unveiling the Sophisticated Phishing Threat In the ever-evolving landscape of cybersecurity, a recent revelation by Microsoft has shed light on a highly... phishing attackhow tomicrosoftexposesmassive https://www.dspit.com.au/2022/02/07/e-mail-from-department-of-labor-could-be-phishing-attack/ E-Mail From Department Of Labor Could Be Phishing Attack - DSP IT Solutions Feb 7, 2022 - There is a new phishing campaign to keep a watchful eye on according to email security firm INKY. It's a particularly fiendish one. The attackers have... department of laborphishing attackit solutionsmailcould https://grcsolutions.io/phishing/ What is Phishing? Attack Techniques & Prevention Tips - GRC Solutions Mar 20, 2026 - Phishing is a type of social engineering attack in which cyber criminals trick victims into handing over sensitive information or installing malware. Learn... what is phishingattack techniquesprevention tipsgrc solutions https://www.cloudns.net/blog/understanding-phishing-attack-and-how-to-stay-protected/ Understanding Phishing Attack and How to Stay Protected - ClouDNS Blog Apr 22, 2026 - A phishing attack is a cybercrime where deceptive messages trick people into giving away sensitive information or performing harmful actions. how to stayphishing attackunderstandingprotectedcloudns https://www.bio-conferences.org/articles/bioconf/ref/2024/16/bioconf_iscku2024_00059/bioconf_iscku2024_00059.html A Two-Stage Hybrid Approach for Phishing Attack Detection Using URL and Content Analysis in IoT |... BIO Web of Conferences, open access proceedings in biology, life sciences and health hybrid approachphishing attackcontent analysistwostage https://iarjset.com/papers/phishing-attack-tactics-detection-and-prevention-effectiveness/ Phishing Attack Tactics Detection And Prevention Effectiveness - IARJSET Abstract: Phishing is one of the most widespread and damaging cyber threats, exploiting human psychology and technological weaknesses to steal sensitive... phishing attacktacticsdetectionpreventioneffectiveness https://www.hypebot.com/tag/phishing-attack/ phishing attack - Hypebot phishing attackhypebot https://www.proofpoint.com/uk/threat-reference/whaling What Is a Whaling Phishing Attack? Definition | Proofpoint UK Jul 31, 2025 - Learn what a whaling phishing attack is in cybersecurity, how it targets high-profile individuals, and key strategies to protect against them with Proofpoint. what is aphishing attackwhalingdefinitionproofpoint https://coinindexnews.com/coinbase-hit-by-insider-phishing-attack/ Coinbase Hit by Insider Phishing Attack - Coin Index News May 15, 2025 - Unveiling the Coinbase Extortion Attempt: A Comprehensive Analysis Our meticulously curated editorial content is overseen by industry-leading experts and... phishing attackindex newscoinbasehitinsider https://blog.admindroid.com/protect-o365-from-phishing-attack-using-external-email-tagging/ Protect Your Organization from Outlook Phishing Attack using External Email Tagging - AdminDroid... Mar 4, 2026 - Adding an external email warning tag prevents users from clicking malicious links and attachments sent by external users. Enable external email tagging now! phishing attackprotectorganizationoutlookusing https://economictimes.indiatimes.com/topic/harvard-phishing-attack harvard phishing attack: Latest News & Videos, Photos about harvard phishing attack | The Economic... harvard phishing attack Latest Breaking News, Pictures, Videos, and Special Reports from The Economic Times. harvard phishing attack Blogs, Comments and... latest news videosphishing attackharvardphotoseconomic https://www.enterpriseitworld.com/wipro-hit-by-an-advanced-phishing-attack/ Wipro hit by an Advanced Phishing Attack - Enterprise IT World Apr 17, 2019 - Wipro confirmed that it has been the target of an advanced phishing attack. It has been reported that Wipro, aware that its email systems have been breached by... enterprise it worldphishing attackwiprohitadvanced https://devicology.com/news/signal-rolls-out-new-security-measures/14892/ Signal Rolls Out New Security Measures After Phishing Attack Surge - Devicology May 5, 2026 - Signal plans new security measures after phishing attacks tricked users into sharing login details, leading to account takeovers. security measuresphishing attacksignalrollsnew https://www.incibe.es/index.php/en/incibe-cert/publications/cybersecurity-highlights/massive-phishing-attack-western-sydney-university Massive phishing attack on Western Sydney University | INCIBE-CERT | INCIBE On October 6, 2025, students and alumni of Western Sydney University (WSU) were targeted by a massive phishing attack via fraudulent emails. western sydney universityphishing attackmassiveincibecert https://www.dbdigest.com/2021/02/rmit-university-melbourne-research.html Data Breaches Digest: RMIT University: Melbourne Research University Suffers Phishing Attack... Daily Digest of Global Data Breaches and Cyber Security News and Advice data breachesrmit universityphishing attackdigestmelbourne https://www.simplilearn.com/tutorials/cryptography-tutorial/what-is-phishing-attack What is Phishing Attack in Cyber Security - Complete Guide Learn what is Phishing Attack and how does it work. Read on to know the different types of phishing and how to prevent from such attack. what is phishingcyber securitycomplete guideattack https://www.sikich.com/insight/how-to-prevent-tabnabbing-mobile-phones/ How to Prevent Tabnabbing, a New Phishing Attack on Mobile Phones Ever heard of tabnabbing? Unsure of how to prevent it on your mobile phone? We explain why you should be aware of it and how to prevent tabnabbing. how to preventphishing attackon mobiletabnabbingnew https://thereviewhive.blog/whatsapp-gmail-phishing-attack-links/ WhatsApp Gmail Phishing Attack Uses Links To Steal Accounts| TheReviewHive Jan 20, 2026 - A new WhatsApp Gmail phishing attack uses malicious links to steal Gmail credentials and hijack WhatsApp accounts through QR codes. Read on to know more phishing attacklinks towhatsappgmailuses https://www.cointrust.com/market-news/cybersecurity-firm-certik-faces-phishing-attack-via-compromised-media-account Cybersecurity Firm Certik Faces Phishing Attack via Compromised Media Account Jan 6, 2024 - Blockchain-focused cybersecurity company Certik recently encountered a phishing attack facilitated through the compromise of a verified media account... phishing attackcybersecurityfirmcertikfaces https://data.stateglobe.com/united-states/phishing-attack-rate-statistics Phishing Attack Rate Statistics in United States (2026) An overview of cybersecurity statistics in the United States for 2026, focusing on phishing attack rates and digital security trends. phishing attackunited statesratestatistics https://okvesty.ru/janaware-ransomware-hits-turkish-users-in-phishing-attack/ JanaWare Ransomware Hits Turkish Users In Phishing Attack - Cybersecurity News & Education - Daily... Apr 15, 2026 - A newly identified cyber campaign involving JanaWare ransomware is targeting users in Turkey, with researchers linking the activity to a customized version of... phishing attackcybersecurity newsransomwarehitsturkish https://candid.technology/phishing-attack-0bj3ctivity-stealer-discord-links/ Phishing attack unleashes 0bj3ctivity Stealer via Discord links In a phishing attack uncovered in July 2024, cybercriminals employed an malware delivery method that bypassed traditional security measures. phishing attackdiscord linksunleashesstealervia https://www.privacy.com.sg/databreach/sans-infosec-training-org-suffers-data-breach-after-phishing-attack/ SANS Infosec Training Org Suffers Data Breach After Phishing Attack Aug 19, 2020 - The SANS cybersecurity training organization has suffered a data breach after one of their employees fell victim to a phishing attack. data breachphishing attacksansinfosectraining https://www.vpnmentor.com/news/clickfix-phishing-exploits-sharepoint-deliver-havoc/ ClickFix Phishing Attack Exploits SharePoint to Deliver Havoc Hackers are leveraging SharePoint in a ClickFix phishing scam, tricking users into running PowerShell commands that install the Havoc C2 framework. phishing attackclickfixexploitssharepointdeliver https://dailysecurityreview.com/news/google-confirms-sophisticated-phishing-attack-targeting-gmail-users-through-dkim-and-oauth-abuse/ Google Confirms Sophisticated Phishing Attack Targeting Gmail Users Through DKIM and OAuth Abuse -... Apr 22, 2025 - Google confirms a phishing campaign targeting Gmail users that abused DKIM and Google Sites to send spoofed legal requests and steal user credentials... phishing attackgooglesophisticatedtargetinggmail https://scholars.cityu.edu.hk/en/publications/a-lightweight-multi-view-learning-approach-for-phishing-attack-de/ A Lightweight Multi-View Learning Approach for Phishing Attack Detection Using Transformer with... multi viewlearning approachphishing attacklightweightdetection https://www.paubox.com/blog/monongalia-health-system-suffers-phishing-attack Monongalia Health System suffers phishing attack | Paubox Yet another healthcare provider, Monongalia Health System, had to notify affected individuals about a recent phishing attack. RELATED: Why is healthcare a health systemphishing attackmonongalia https://www.cysecurity.news/2014/02/target-breach-spear-phishing-attack.html Target data breach started with a Spear phishing attack targeting HVAC firm - CySecurity News -... A latest information on Target data breach published by security blogger Brian Krebs shows the power of Social Engineering attacks. target dataspear phishingbreachstartedattack https://learn.microsoft.com/en-us/defender-office-365/attack-simulation-training-simulations?view=o365-worldwide&preserve-view=true Simulate a phishing attack with Attack simulation training - Microsoft Defender for Office 365 |... Admins can learn how to simulate phishing attacks and train their users on phishing prevention using Attack simulation training in Microsoft Defender for... phishing attacksimulation trainingmicrosoft defenderfor officesimulate https://www.computerweekly.com/news/252526838/Dropbox-code-compromised-in-phishing-attack Dropbox code compromised in phishing attack | Computer Weekly Cloud storage service says malicious actors successfully accessed some of its code within GitHub, but insists customer data is secure. phishing attackcomputer weeklydropboxcodecompromised https://www.anchornetworksolutions.com/tag/phishing-attack/ phishing attack Archives - Anchor Network Solutions, Inc phishing attackanchor networkarchivessolutionsinc https://www.hcltech.com/ja-jp/knowledge-library/what-is-a-phishing-attack-in-cybersecurity What Is a Phishing Attack in Cybersecurity? Types and Risks | HCLTech Japan Protect your enterprise from phishing attacks. Learn about credential theft, BEC, social engineering and effective prevention strategies. Explore now. what is aphishing attackcybersecuritytypesrisks https://www.tines.com/library/stories/1223858/ Run a simulated phishing attack | Library | Tines Get a list of employees from BambooHR and send them a simulated phishing email. A Tines Case will be created tracking if a link in the email is clicked. simulated phishing attackrunlibrarytines https://madison365.com/google-docs-sophisticated-phishing-attack-spreading-fast/ Google Docs Sophisticated Phishing Attack Spreading Fast | Madison365 Alphabet Inc (GOOGL.O) said today it was investigating widespread reports about a spam campaign in which recipients received emails from known contacts that... google docsphishing attacksophisticatedspreadingfast https://coinscreamer.com/guides/what-is-crypto-phishing-attack-beginners-guide/ What Is a Phishing Attack in Crypto: A Beginner's Guide to Protecting Your Wallet | CoinScreamer Learn how scammers use fake websites and malicious smart contracts to drain wallets, and how to protect your digital assets. what is aphishing attackguide toyour walletcrypto https://heimdalsecurity.com/blog/phishing-attack-uses-facebook-posts-to-evade-email-security/ Phishing Attack Uses Facebook Posts to Evade Email Security Dec 16, 2022 - Phishing attacks continue to be on the rise, targeting a significant number of Facebook users and stealing their account credentials. phishing attackfacebook postsemail securityusesevade https://blog.bobshop.co.za/phishing-attack-posing-as-a-warning/ Phishing attack posing as a warning - Bob Shop Blog Feb 8, 2023 - It is difficult to differentiate between various kinds of scum and say which one is worse than the other. Still, it is probably safe to say that the most... phishing attackbob shopposingwarningblog https://onlinetutorialhub.com/ccna/phishing-vs-spear-phishing/ What Is Spear Phishing Attack? Phishing Vs Spear Phishing Sep 25, 2025 - Phishing vs Spear Phishing: Compare social engineering, targeting, and attack sophistication. Learn why personalised attacks are more dangerous. what isspear phishingattackvs https://thebitgazette.com/aave-phishing-attack-shocks-users-after-60b-milestone/ Aave phishing attack shocks users after $60b milestone - The Bit Gazette Aug 7, 2025 - Aave phishing attack strikes the DeFi world less than 24 hours after the protocol celebrated surpassing $60 billion in net phishing attackaaveshocksusersmilestone https://www.macrumors.com/2020/07/31/twitter-hack-used-spear-phishing-attack/ Twitter Hackers Used 'Phone Spear Phishing Attack' to Pull Off Bitcoin Scam - MacRumors Twitter has provided another update on the security breach two weeks ago that saw the Twitter accounts of Apple and other high-profile figures and companies... used phonespear phishingtwitterhackersattack https://cyberwebspider.com/cyber-security-news/hackers-using-malicious-imageless-qr-codes-to-render-phishing-attack-via-html-table/ Hackers Using Malicious Imageless QR Codes to Render Phishing Attack Via HTML Table - Cyber Web... Jan 7, 2026 - A current phishing marketing campaign is abusing QR codes in a brand new manner, turning easy HTML tables into working codes that redirect customers to qr codesphishing attackhtml tablehackersusing https://montgomeryhousebuyer.com/ montgomeryhousebuyer.com | Phishing attack phishing attack https://bitwarden.com/blog/what-is-a-common-indicator-of-phishing/ How to identify a phishing attack | Bitwarden Discover what a common indicator of a phishing attempt looks like and learn how to protect yourself and your business. The Bitwarden blog provides essential... how to identifyphishing attackbitwarden https://www.ynetnews.com/tech-and-digital/article/bkhhgorile Israeli startup, cyber authority foil major phishing attack mimicking government site Sep 22, 2025 - Malmanta AI used artificial intelligence to detect dozens of fake domains copying Israeli government and security agencies; The National Cyber Directorate... israeli startupphishing attackgovernment sitecyberauthority https://school.infosec4tc.com/courses/the-complete-ethical-hacker-certification-course/lectures/6542628 81. Phishing Attack | InfoSec4TC This course is covering over 270 attack technologies that hackers use. phishing attack https://www.itsecuritynews.info/phishing-attack-weaponizes-calendar-invites-to-steal-login-credentials/ Phishing Attack Weaponizes Calendar Invites to Steal Login Credentials - IT Security News May 6, 2026 - A new large-scale phishing campaign is abusing fake event invitations to compromise U.S. organizations, combining credential theft, OTP interception, and the... it security newsphishing attackcalendar inviteslogin credentialssteal https://www.reverseau.com/blog/docusign-apple-pay-scam-how-to-spot-and-avoid-this-phishing-attack.html Docusign Apple Pay Scam: How to Spot and Avoid This Phishing Attack Scammers are impersonating Docusign to target Apple Pay users with fake receipts and support numbers. Learn how this sophisticated phishing campaign works and... apple payhow toavoid thisphishing attackdocusign https://bitnewsbot.com/zoom-phishing-attack-targets-manta-network-co-founder-with-fake-videos/ Zoom Phishing Attack Targets Manta Network Co-founder With Fake Videos Apr 18, 2025 - Kenny Li, co-founder of Manta Network, recently evaded what he describes as a highly sophisticated phishing attempt during a Zoom call. The attack featured phishing attackmanta networkco founderzoomtargets https://www.infosecurity-magazine.com/news/ai-military-ids-north-korea/ AI-Forged Military IDs Used in North Korean Phishing Attack - Infosecurity Magazine Sep 15, 2025 - Genians observed the Kimsuky group impersonate a defense institution in a spear-phishing attack, leveraging ChatGPT to create fake military ID cards used innorth koreanphishing attackinfosecurity magazineai https://fmttmboro.com/index.php?threads/another-scumbag-phishing-attack-scam-coronavirus.2050/ Another Scumbag Phishing Attack Scam - Coronavirus | FMTTM As previously mentioned, I know most on here are well aware of these scumbags attempting to profiteer from anything and everything. Latest is one variant of... phishing attackanotherscumbagscamcoronavirus https://underconstructionpage.com/phishing-attack-prevention-how-to-identify-avoid-phishing/ Phishing Attack Prevention: How to Identify & Avoid Phishing Jun 30, 2025 - Phishing is one of the most dangerous threats that both individuals and organizations face in the cybersecurity world. According to Proofpoint 2022 Report, 83%... how to identifyphishing attackpreventionavoid https://businessmetricsng.com/tag/phishing-attack-exploit/ Phishing Attack Exploit Archives - Business Metrics News for Economic Intelligence phishing attackbusiness metricsexploitarchives https://iplogger.org/blog/tag/phishing-attack/ phishing-attack ::description_blog_tag phishing attack https://cryptomufasa.com/phishing-attack-hackers-drained-cryptocurrency/ Phishing Attack Exposed: How Chinese Hackers Drained Cryptocurrency via Fake Skype | Crypto Mufasa Nov 14, 2023 - Cybersecurity firm SlowMist has exposed a sophisticated phishing attack, revealing the manipulation of a counterfeit Skype app by Chinese hackers. phishing attackchinese hackersexposeddrainedcryptocurrency https://www.govtech.com/education/k-12/phishing-attack-hits-new-haven-conn-school-system Phishing Attack Hits New Haven, Conn., School System Nov 20, 2025 - A "sophisticated phishing attack" targeting New Haven Public Schools came after accounts belonging to at least four students were compromised. More than 10,000... phishing attacknew havenschool systemhitsconn https://www.internetnews.me/2015/06/09/phishing-attack-targets-nl-registrants/ Phishing Attack Targets .Nl Registrants Jun 9, 2015 - SIDN, the .nl domain name registry, has issued an alert to its registrars about a phishing attack targetting .nl registrants. The emails carry the subject phishing attacktargetsnlregistrants https://ictframe.com/tag/phishing-attack/ Phishing Attack | ICT Frame | Tech News, Reviews & Digital Updates from Nepal phishing attacktech newsdigital updatesfrom nepalict https://news.drweb.com/show/?i=14899 Gaining persistence in a compromised system using Yandex Browser. Failed spear phishing attack on... Social engineering is a highly effective fraud technique that is difficult to withstand. A skilled attacker knows how to find the right approach to intimidate... in ayandex browserspear phishinggainingpersistence https://www.web3isgoinggreat.com/?id=etherfi-phishing Phishing attack drains $2 million from one victim An Ethereum holder who had been staking their ETH through a liquid restaking protocol called Ether.fi suffered a 501 ETH (~$2.025 million) loss when they fell... phishing attackdrainsmilliononevictim https://www.xcitium.com/blog/web-security/what-is-a-spear-phishing-attack/ What Is a Spear Phishing Attack? | Common Spear Phishing Attack Examples Learn what is a spear phishing attack, how it works, real examples, and how organizations can prevent targeted phishing threats. what is aspear phishingcommon examplesattack