https://anteelo.com/10-ways-to-prevent-phishing-attack-in-2020/
Ways of Averting Phishing Attack - Anteelo Design Private Limited
Jun 3, 2021 - Phishing attack is basically the most common but dangerous cyber-attack vector that is capable of exploiting the entire data of an...
phishing attackwaysdesignprivatelimited
https://thehackernews.com/2017/01/gmail-phishing-page.html
Don't Fall For This Dangerously Convincing Ongoing Phishing Attack
Beware, Don't fall for this Convincing Gmail Phishing Scam.
phishing attackfalldangerouslyconvincingongoing
https://cyberwarriorsmiddleeast.com/phishing-attack-successfully-evades-fido-key-security/
Phishing Attack Successfully Evades FIDO Key Security - Cyber Warriors Middle East
Jul 21, 2025 - A recent discovery by a managed detection and response (MDR) provider has unveiled a phishing campaign that effectively bypasses FIDO key authentication. This
phishing attackcyber warriorsmiddle eastsuccessfullyfido
https://www.itpro.com/security/phishing/361042/hackers-spoof-zix-in-credential-phishing-attack
Hackers spoof Zix in credential phishing attack | IT Pro
Sep 28, 2021 - The attack has impacted around 75,000 Office 365, Google Workspace and Exchange users
phishing attackit prohackersspoofcredential
https://aviatrix.ai/threat-research-center/obfuscated-javascript-phishing-attack-april-2026/
Obfuscated JavaScript Phishing Attack Delivers FormBook Malware - April 2026
In April 2026, a sophisticated phishing campaign used obfuscated JavaScript to deliver FormBook malware, evading detection through multi-stage payloads and...
obfuscated javascriptphishing attackdeliversmalwareapril
https://www.digitalinformationworld.com/2021/06/hackers-are-using-google-docs-as.html
Hackers Are Using Google Docs As A Platform For Yet Another Dangerous Phishing Attack
Here's how Google Docs is being utilized as a tool for spearheading phishing attacks against other members of the community.
google docsas ayet anotherphishing attackhackers
https://blog.knowbe4.com/dns-hijacking-almost-always-starts-with-a-successful-spear-phishing-attack
DNS Hijacking Almost Always Starts With A Successful Spear Phishing Attack
DNS Hijacking Almost Always Starts With A Successful Spear Phishing Attack
dns hijackingalmost alwaysstarts withspear phishingsuccessful
https://www.indiablooms.com/life/35000-users-hacked-microsoft-reveals-massive-global-phishing-attack/details
35,000 users hacked? Microsoft reveals massive global phishing attack | Indiablooms - First Portal...
May 6, 2026 - Microsoft has uncovered a massive global phishing campaign targeting over 35,000 users across 13,000 organisations in 26 countries. | One of India's leading...
phishing attackusershackedmicrosoftreveals
https://www.verdict.co.uk/walkme-files-patent-for-the-patent-is-filed-for-a-method-to-detect-phishing-attacks/
WalkMe Ltd Files Patent for Phishing Attack Detection Method
Nov 28, 2023 - Detect and respond to phishing attacks with a patented method. Analyze visual similarity between source and target pages to classify attacks and take...
phishing attackwalkmeltdfilespatent
https://www.trendmicro.com/vinfo/us/security/news/cybercrime-and-digital-threats/seagate-employees-face-possible-tax-fraud-in-recent-phishing-attack
Seagate Employees Face Possible Tax Fraud in Recent Phishing Attack | Trend Micro (US)
Storage device manufacturing company Seagate, announced a successful phishing attack that placed a number of present and former employees at risk of potential...
tax fraudphishing attacktrend microseagateemployees
https://protos.com/phishing-attack-on-software-firm-retool-enabled-fortress-trust-hack-coindesk/
Phishing attack on software firm Retool enabled Fortress Trust hack: CoinDesk
Sep 14, 2023 - Fortress Trust claimed no funds were lost following a $15M crypto hack now revealed by CoinDesk to have occurred through Retool.
phishing attackon softwarefirmretoolenabled
https://www.stimulustech.com/2022/11/07/dropbox-suffers-major-breach-in-phishing-attack/
Dropbox Suffers Major Breach in Phishing Attack - Stimulus Technologies
Nov 7, 2022 - It's no secret that cyber attacks are on the rise, and that no company is immune to them. Dropbox, a cloud storage company, was the lastest victim when their...
phishing attackdropboxmajorbreachstimulus
https://www.techathand.net/tips-and-tricks/phishing-attack-using-paypal/314/
Phishing Attack using PayPal - Tech At Hand Dot Net
Oct 20, 2016 - I just received a unique PayPal Scam. This is the firs time I receive such kind of email. And after checking the links of the [more...]
phishing attackdot netusingpaypaltech
https://bitday.net/major-phishing-attack-on-venus-protocol-results-in-27-million-loss/
Venus Protocol Phishing Attack
Sep 3, 2025 - Venus Protocol suffers $27M loss due to a large-scale phishing attack; security review underway.
phishing attackvenusprotocol
https://www.technologistan.pk/hacker-steals-1-7-million-worth-of-nfts-from-opensea-users/
OpenSea Loses$1.7 Million in NFTs in Phishing Attack
Feb 21, 2022 - Technologistan is a technology media platform, dedicated to the coverage of news from different regions with a special focus on Pakistan.
phishing attackopensealosesmillionnfts
https://www.lobstersauce.news/p/phishing-attack-targets-openclaw-developers-via-github
Phishing attack targets OpenClaw developers via GitHub | lobstersauce.news
A recent phishing attack has targeted OpenClaw developers via GitHub, as reported by OX Security. The attackers have been creating fake accounts and posting fra
phishing attackvia githubtargetsopenclawdevelopers
https://2wtech.com/new-phishing-attack-is-hitting-office-365-accounts/
New Phishing Attack is Hitting Office 365 Accounts - 2WTech
Dec 24, 2018 - This phishing attack steals Microsoft account credentials by sending out emails that look like email non-delivery notifications from Office 365.
phishing attacknewhittingofficeaccounts
https://www.veracode.com/blog/ledger-phishing-attack-connect-kit/
Ledger npm Repo Breached in Spear Phishing Attack | Veracode
Jun 4, 2025 - Application Security for the AI Era | Veracode
spear phishingledgernpmrepoattack
https://umdloti.org/article/microsoft-exposes-massive-phishing-attack-how-to-protect-your-organization-in-2026
Microsoft Exposes Massive Phishing Attack: How to Protect Your Organization in 2026 (2026)
May 17, 2026 - Unveiling the Sophisticated Phishing Threat In the ever-evolving landscape of cybersecurity, a recent revelation by Microsoft has shed light on a highly...
phishing attackhow tomicrosoftexposesmassive
https://www.dspit.com.au/2022/02/07/e-mail-from-department-of-labor-could-be-phishing-attack/
E-Mail From Department Of Labor Could Be Phishing Attack - DSP IT Solutions
Feb 7, 2022 - There is a new phishing campaign to keep a watchful eye on according to email security firm INKY. It's a particularly fiendish one. The attackers have...
department of laborphishing attackit solutionsmailcould
https://grcsolutions.io/phishing/
What is Phishing? Attack Techniques & Prevention Tips - GRC Solutions
Mar 20, 2026 - Phishing is a type of social engineering attack in which cyber criminals trick victims into handing over sensitive information or installing malware. Learn...
what is phishingattack techniquesprevention tipsgrc solutions
https://www.cloudns.net/blog/understanding-phishing-attack-and-how-to-stay-protected/
Understanding Phishing Attack and How to Stay Protected - ClouDNS Blog
Apr 22, 2026 - A phishing attack is a cybercrime where deceptive messages trick people into giving away sensitive information or performing harmful actions.
how to stayphishing attackunderstandingprotectedcloudns
https://www.bio-conferences.org/articles/bioconf/ref/2024/16/bioconf_iscku2024_00059/bioconf_iscku2024_00059.html
A Two-Stage Hybrid Approach for Phishing Attack Detection Using URL and Content Analysis in IoT |...
BIO Web of Conferences, open access proceedings in biology, life sciences and health
hybrid approachphishing attackcontent analysistwostage
https://iarjset.com/papers/phishing-attack-tactics-detection-and-prevention-effectiveness/
Phishing Attack Tactics Detection And Prevention Effectiveness - IARJSET
Abstract: Phishing is one of the most widespread and damaging cyber threats, exploiting human psychology and technological weaknesses to steal sensitive...
phishing attacktacticsdetectionpreventioneffectiveness
https://www.hypebot.com/tag/phishing-attack/
phishing attack - Hypebot
phishing attackhypebot
https://www.proofpoint.com/uk/threat-reference/whaling
What Is a Whaling Phishing Attack? Definition | Proofpoint UK
Jul 31, 2025 - Learn what a whaling phishing attack is in cybersecurity, how it targets high-profile individuals, and key strategies to protect against them with Proofpoint.
what is aphishing attackwhalingdefinitionproofpoint
https://coinindexnews.com/coinbase-hit-by-insider-phishing-attack/
Coinbase Hit by Insider Phishing Attack - Coin Index News
May 15, 2025 - Unveiling the Coinbase Extortion Attempt: A Comprehensive Analysis Our meticulously curated editorial content is overseen by industry-leading experts and...
phishing attackindex newscoinbasehitinsider
https://blog.admindroid.com/protect-o365-from-phishing-attack-using-external-email-tagging/
Protect Your Organization from Outlook Phishing Attack using External Email Tagging - AdminDroid...
Mar 4, 2026 - Adding an external email warning tag prevents users from clicking malicious links and attachments sent by external users. Enable external email tagging now!
phishing attackprotectorganizationoutlookusing
https://economictimes.indiatimes.com/topic/harvard-phishing-attack
harvard phishing attack: Latest News & Videos, Photos about harvard phishing attack | The Economic...
harvard phishing attack Latest Breaking News, Pictures, Videos, and Special Reports from The Economic Times. harvard phishing attack Blogs, Comments and...
latest news videosphishing attackharvardphotoseconomic
https://www.enterpriseitworld.com/wipro-hit-by-an-advanced-phishing-attack/
Wipro hit by an Advanced Phishing Attack - Enterprise IT World
Apr 17, 2019 - Wipro confirmed that it has been the target of an advanced phishing attack. It has been reported that Wipro, aware that its email systems have been breached by...
enterprise it worldphishing attackwiprohitadvanced
https://devicology.com/news/signal-rolls-out-new-security-measures/14892/
Signal Rolls Out New Security Measures After Phishing Attack Surge - Devicology
May 5, 2026 - Signal plans new security measures after phishing attacks tricked users into sharing login details, leading to account takeovers.
security measuresphishing attacksignalrollsnew
https://www.incibe.es/index.php/en/incibe-cert/publications/cybersecurity-highlights/massive-phishing-attack-western-sydney-university
Massive phishing attack on Western Sydney University | INCIBE-CERT | INCIBE
On October 6, 2025, students and alumni of Western Sydney University (WSU) were targeted by a massive phishing attack via fraudulent emails.
western sydney universityphishing attackmassiveincibecert
https://www.dbdigest.com/2021/02/rmit-university-melbourne-research.html
Data Breaches Digest: RMIT University: Melbourne Research University Suffers Phishing Attack...
Daily Digest of Global Data Breaches and Cyber Security News and Advice
data breachesrmit universityphishing attackdigestmelbourne
https://www.simplilearn.com/tutorials/cryptography-tutorial/what-is-phishing-attack
What is Phishing Attack in Cyber Security - Complete Guide
Learn what is Phishing Attack and how does it work. Read on to know the different types of phishing and how to prevent from such attack.
what is phishingcyber securitycomplete guideattack
https://www.sikich.com/insight/how-to-prevent-tabnabbing-mobile-phones/
How to Prevent Tabnabbing, a New Phishing Attack on Mobile Phones
Ever heard of tabnabbing? Unsure of how to prevent it on your mobile phone? We explain why you should be aware of it and how to prevent tabnabbing.
how to preventphishing attackon mobiletabnabbingnew
https://thereviewhive.blog/whatsapp-gmail-phishing-attack-links/
WhatsApp Gmail Phishing Attack Uses Links To Steal Accounts| TheReviewHive
Jan 20, 2026 - A new WhatsApp Gmail phishing attack uses malicious links to steal Gmail credentials and hijack WhatsApp accounts through QR codes. Read on to know more
phishing attacklinks towhatsappgmailuses
https://www.cointrust.com/market-news/cybersecurity-firm-certik-faces-phishing-attack-via-compromised-media-account
Cybersecurity Firm Certik Faces Phishing Attack via Compromised Media Account
Jan 6, 2024 - Blockchain-focused cybersecurity company Certik recently encountered a phishing attack facilitated through the compromise of a verified media account...
phishing attackcybersecurityfirmcertikfaces
https://data.stateglobe.com/united-states/phishing-attack-rate-statistics
Phishing Attack Rate Statistics in United States (2026)
An overview of cybersecurity statistics in the United States for 2026, focusing on phishing attack rates and digital security trends.
phishing attackunited statesratestatistics
https://okvesty.ru/janaware-ransomware-hits-turkish-users-in-phishing-attack/
JanaWare Ransomware Hits Turkish Users In Phishing Attack - Cybersecurity News & Education - Daily...
Apr 15, 2026 - A newly identified cyber campaign involving JanaWare ransomware is targeting users in Turkey, with researchers linking the activity to a customized version of...
phishing attackcybersecurity newsransomwarehitsturkish
https://candid.technology/phishing-attack-0bj3ctivity-stealer-discord-links/
Phishing attack unleashes 0bj3ctivity Stealer via Discord links
In a phishing attack uncovered in July 2024, cybercriminals employed an malware delivery method that bypassed traditional security measures.
phishing attackdiscord linksunleashesstealervia
https://www.privacy.com.sg/databreach/sans-infosec-training-org-suffers-data-breach-after-phishing-attack/
SANS Infosec Training Org Suffers Data Breach After Phishing Attack
Aug 19, 2020 - The SANS cybersecurity training organization has suffered a data breach after one of their employees fell victim to a phishing attack.
data breachphishing attacksansinfosectraining
https://www.vpnmentor.com/news/clickfix-phishing-exploits-sharepoint-deliver-havoc/
ClickFix Phishing Attack Exploits SharePoint to Deliver Havoc
Hackers are leveraging SharePoint in a ClickFix phishing scam, tricking users into running PowerShell commands that install the Havoc C2 framework.
phishing attackclickfixexploitssharepointdeliver
https://dailysecurityreview.com/news/google-confirms-sophisticated-phishing-attack-targeting-gmail-users-through-dkim-and-oauth-abuse/
Google Confirms Sophisticated Phishing Attack Targeting Gmail Users Through DKIM and OAuth Abuse -...
Apr 22, 2025 - Google confirms a phishing campaign targeting Gmail users that abused DKIM and Google Sites to send spoofed legal requests and steal user credentials...
phishing attackgooglesophisticatedtargetinggmail
https://scholars.cityu.edu.hk/en/publications/a-lightweight-multi-view-learning-approach-for-phishing-attack-de/
A Lightweight Multi-View Learning Approach for Phishing Attack Detection Using Transformer with...
multi viewlearning approachphishing attacklightweightdetection
https://www.paubox.com/blog/monongalia-health-system-suffers-phishing-attack
Monongalia Health System suffers phishing attack | Paubox
Yet another healthcare provider, Monongalia Health System, had to notify affected individuals about a recent phishing attack. RELATED: Why is healthcare a
health systemphishing attackmonongalia
https://www.cysecurity.news/2014/02/target-breach-spear-phishing-attack.html
Target data breach started with a Spear phishing attack targeting HVAC firm - CySecurity News -...
A latest information on Target data breach published by security blogger Brian Krebs shows the power of Social Engineering attacks.
target dataspear phishingbreachstartedattack
https://learn.microsoft.com/en-us/defender-office-365/attack-simulation-training-simulations?view=o365-worldwide&preserve-view=true
Simulate a phishing attack with Attack simulation training - Microsoft Defender for Office 365 |...
Admins can learn how to simulate phishing attacks and train their users on phishing prevention using Attack simulation training in Microsoft Defender for...
phishing attacksimulation trainingmicrosoft defenderfor officesimulate
https://www.computerweekly.com/news/252526838/Dropbox-code-compromised-in-phishing-attack
Dropbox code compromised in phishing attack | Computer Weekly
Cloud storage service says malicious actors successfully accessed some of its code within GitHub, but insists customer data is secure.
phishing attackcomputer weeklydropboxcodecompromised
https://www.anchornetworksolutions.com/tag/phishing-attack/
phishing attack Archives - Anchor Network Solutions, Inc
phishing attackanchor networkarchivessolutionsinc
https://www.hcltech.com/ja-jp/knowledge-library/what-is-a-phishing-attack-in-cybersecurity
What Is a Phishing Attack in Cybersecurity? Types and Risks | HCLTech Japan
Protect your enterprise from phishing attacks. Learn about credential theft, BEC, social engineering and effective prevention strategies. Explore now.
what is aphishing attackcybersecuritytypesrisks
https://www.tines.com/library/stories/1223858/
Run a simulated phishing attack | Library | Tines
Get a list of employees from BambooHR and send them a simulated phishing email. A Tines Case will be created tracking if a link in the email is clicked.
simulated phishing attackrunlibrarytines
https://madison365.com/google-docs-sophisticated-phishing-attack-spreading-fast/
Google Docs Sophisticated Phishing Attack Spreading Fast | Madison365
Alphabet Inc (GOOGL.O) said today it was investigating widespread reports about a spam campaign in which recipients received emails from known contacts that...
google docsphishing attacksophisticatedspreadingfast
https://coinscreamer.com/guides/what-is-crypto-phishing-attack-beginners-guide/
What Is a Phishing Attack in Crypto: A Beginner's Guide to Protecting Your Wallet | CoinScreamer
Learn how scammers use fake websites and malicious smart contracts to drain wallets, and how to protect your digital assets.
what is aphishing attackguide toyour walletcrypto
https://heimdalsecurity.com/blog/phishing-attack-uses-facebook-posts-to-evade-email-security/
Phishing Attack Uses Facebook Posts to Evade Email Security
Dec 16, 2022 - Phishing attacks continue to be on the rise, targeting a significant number of Facebook users and stealing their account credentials.
phishing attackfacebook postsemail securityusesevade
https://blog.bobshop.co.za/phishing-attack-posing-as-a-warning/
Phishing attack posing as a warning - Bob Shop Blog
Feb 8, 2023 - It is difficult to differentiate between various kinds of scum and say which one is worse than the other. Still, it is probably safe to say that the most...
phishing attackbob shopposingwarningblog
https://onlinetutorialhub.com/ccna/phishing-vs-spear-phishing/
What Is Spear Phishing Attack? Phishing Vs Spear Phishing
Sep 25, 2025 - Phishing vs Spear Phishing: Compare social engineering, targeting, and attack sophistication. Learn why personalised attacks are more dangerous.
what isspear phishingattackvs
https://thebitgazette.com/aave-phishing-attack-shocks-users-after-60b-milestone/
Aave phishing attack shocks users after $60b milestone - The Bit Gazette
Aug 7, 2025 - Aave phishing attack strikes the DeFi world less than 24 hours after the protocol celebrated surpassing $60 billion in net
phishing attackaaveshocksusersmilestone
https://www.macrumors.com/2020/07/31/twitter-hack-used-spear-phishing-attack/
Twitter Hackers Used 'Phone Spear Phishing Attack' to Pull Off Bitcoin Scam - MacRumors
Twitter has provided another update on the security breach two weeks ago that saw the Twitter accounts of Apple and other high-profile figures and companies...
used phonespear phishingtwitterhackersattack
https://cyberwebspider.com/cyber-security-news/hackers-using-malicious-imageless-qr-codes-to-render-phishing-attack-via-html-table/
Hackers Using Malicious Imageless QR Codes to Render Phishing Attack Via HTML Table - Cyber Web...
Jan 7, 2026 - A current phishing marketing campaign is abusing QR codes in a brand new manner, turning easy HTML tables into working codes that redirect customers to
qr codesphishing attackhtml tablehackersusing
https://montgomeryhousebuyer.com/
montgomeryhousebuyer.com | Phishing attack
phishing attack
https://bitwarden.com/blog/what-is-a-common-indicator-of-phishing/
How to identify a phishing attack | Bitwarden
Discover what a common indicator of a phishing attempt looks like and learn how to protect yourself and your business. The Bitwarden blog provides essential...
how to identifyphishing attackbitwarden
https://www.ynetnews.com/tech-and-digital/article/bkhhgorile
Israeli startup, cyber authority foil major phishing attack mimicking government site
Sep 22, 2025 - Malmanta AI used artificial intelligence to detect dozens of fake domains copying Israeli government and security agencies; The National Cyber Directorate...
israeli startupphishing attackgovernment sitecyberauthority
https://school.infosec4tc.com/courses/the-complete-ethical-hacker-certification-course/lectures/6542628
81. Phishing Attack | InfoSec4TC
This course is covering over 270 attack technologies that hackers use.
phishing attack
https://www.itsecuritynews.info/phishing-attack-weaponizes-calendar-invites-to-steal-login-credentials/
Phishing Attack Weaponizes Calendar Invites to Steal Login Credentials - IT Security News
May 6, 2026 - A new large-scale phishing campaign is abusing fake event invitations to compromise U.S. organizations, combining credential theft, OTP interception, and the...
it security newsphishing attackcalendar inviteslogin credentialssteal
https://www.reverseau.com/blog/docusign-apple-pay-scam-how-to-spot-and-avoid-this-phishing-attack.html
Docusign Apple Pay Scam: How to Spot and Avoid This Phishing Attack
Scammers are impersonating Docusign to target Apple Pay users with fake receipts and support numbers. Learn how this sophisticated phishing campaign works and...
apple payhow toavoid thisphishing attackdocusign
https://bitnewsbot.com/zoom-phishing-attack-targets-manta-network-co-founder-with-fake-videos/
Zoom Phishing Attack Targets Manta Network Co-founder With Fake Videos
Apr 18, 2025 - Kenny Li, co-founder of Manta Network, recently evaded what he describes as a highly sophisticated phishing attempt during a Zoom call. The attack featured
phishing attackmanta networkco founderzoomtargets
https://www.infosecurity-magazine.com/news/ai-military-ids-north-korea/
AI-Forged Military IDs Used in North Korean Phishing Attack - Infosecurity Magazine
Sep 15, 2025 - Genians observed the Kimsuky group impersonate a defense institution in a spear-phishing attack, leveraging ChatGPT to create fake military ID cards
used innorth koreanphishing attackinfosecurity magazineai
https://fmttmboro.com/index.php?threads/another-scumbag-phishing-attack-scam-coronavirus.2050/
Another Scumbag Phishing Attack Scam - Coronavirus | FMTTM
As previously mentioned, I know most on here are well aware of these scumbags attempting to profiteer from anything and everything. Latest is one variant of...
phishing attackanotherscumbagscamcoronavirus
https://underconstructionpage.com/phishing-attack-prevention-how-to-identify-avoid-phishing/
Phishing Attack Prevention: How to Identify & Avoid Phishing
Jun 30, 2025 - Phishing is one of the most dangerous threats that both individuals and organizations face in the cybersecurity world. According to Proofpoint 2022 Report, 83%...
how to identifyphishing attackpreventionavoid
https://businessmetricsng.com/tag/phishing-attack-exploit/
Phishing Attack Exploit Archives - Business Metrics
News for Economic Intelligence
phishing attackbusiness metricsexploitarchives
https://iplogger.org/blog/tag/phishing-attack/
phishing-attack
::description_blog_tag
phishing attack
https://cryptomufasa.com/phishing-attack-hackers-drained-cryptocurrency/
Phishing Attack Exposed: How Chinese Hackers Drained Cryptocurrency via Fake Skype | Crypto Mufasa
Nov 14, 2023 - Cybersecurity firm SlowMist has exposed a sophisticated phishing attack, revealing the manipulation of a counterfeit Skype app by Chinese hackers.
phishing attackchinese hackersexposeddrainedcryptocurrency
https://www.govtech.com/education/k-12/phishing-attack-hits-new-haven-conn-school-system
Phishing Attack Hits New Haven, Conn., School System
Nov 20, 2025 - A "sophisticated phishing attack" targeting New Haven Public Schools came after accounts belonging to at least four students were compromised. More than 10,000...
phishing attacknew havenschool systemhitsconn
https://www.internetnews.me/2015/06/09/phishing-attack-targets-nl-registrants/
Phishing Attack Targets .Nl Registrants
Jun 9, 2015 - SIDN, the .nl domain name registry, has issued an alert to its registrars about a phishing attack targetting .nl registrants. The emails carry the subject
phishing attacktargetsnlregistrants
https://ictframe.com/tag/phishing-attack/
Phishing Attack | ICT Frame | Tech News, Reviews & Digital Updates from Nepal
phishing attacktech newsdigital updatesfrom nepalict
https://news.drweb.com/show/?i=14899
Gaining persistence in a compromised system using Yandex Browser. Failed spear phishing attack on...
Social engineering is a highly effective fraud technique that is difficult to withstand. A skilled attacker knows how to find the right approach to intimidate...
in ayandex browserspear phishinggainingpersistence
https://www.web3isgoinggreat.com/?id=etherfi-phishing
Phishing attack drains $2 million from one victim
An Ethereum holder who had been staking their ETH through a liquid restaking protocol called Ether.fi suffered a 501 ETH (~$2.025 million) loss when they fell...
phishing attackdrainsmilliononevictim
https://www.xcitium.com/blog/web-security/what-is-a-spear-phishing-attack/
What Is a Spear Phishing Attack? | Common Spear Phishing Attack Examples
Learn what is a spear phishing attack, how it works, real examples, and how organizations can prevent targeted phishing threats.
what is aspear phishingcommon examplesattack