https://new-klima.pl/en/production-machinery-service/
Production machinery service - NEW KLIMA Sp. z o. o.
production machineryservicenewklimasp
https://www.chinasupplierlist.com/textiles-leather-products/textile-leather-machinery/leather-production-machinery-parts.html
Leather Production Machinery Parts - China Leather Production Machinery Parts Suppliers
leather productionmachinery partschinasuppliers
https://imsindustrial.co.uk/
Industrial Maintenance Services Ltd, Portsmouth | Production Machinery and Facilities Maintenance
industrial maintenanceproduction machineryservicesltdportsmouth
https://haochenkeji.en.made-in-china.com/product/hAWRtbwTqJrD/China-Premium-Durable-Steel-Pipe-Production-Machinery-for-Global-Markets.html
Premium Durable Steel Pipe Production Machinery for Global Markets - Painting Line and Painting...
Premium Durable Steel Pipe Production Machinery for Global Markets, Find Details and Price about Painting Line Painting Production Line from Premium Durable...
steel pipeproduction machinery
https://loadfeet.com/seismic-levelling-feet-for-food-production-machinery/
Seismic Levelling Feet for Food Production Machinery | Order | NHK Group
Mar 16, 2026 - Discover how seismic levelling feet for food production machinery improve stability, floor retention, hygiene, and uptime.
levelling feetfood productionseismicmachineryorder
https://aacblockmanufacturingplant.com/ms/aac-block-production-machinery/
AAC Block Production Machinery | Process Flow and Cost
Apr 24, 2026 - Complete guide to AAC block production machinery including process flow, automation levels, cost analysis, and production optimization. Contact Us now!
aac blockproduction machineryprocess flowcost
https://www.penhuipress.com/tag/tag_id/876502,978819,877334/
Production Machinery Anhui Province, China | Maanshan Penghui Heavy Industry Machinery Technologies...
Maanshan Penghui Heavy Industry Machinery Technologies Co. Ltd - Production Machinery Anhui Province, China , Maanshan Penghui Heavy Industry Machinery...
production machineryanhui provinceheavy industrychinamaanshan
https://www.chinayouyue.com/How-to-Choose-the-Right-Sausage-Production-Machinery-id63897707.html
How to Choose the Right Sausage Production Machinery - Shandong Youyue
How to Choose the Right Sausage Production Machinery, Shandong Youyue
how to choose theproduction machineryrightsausageshandong
https://www.impreglon.co.uk/topmenu/sectors/food/
Coatings and applications for food production machinery and more.
Coatings and applications for food production machinery and more from Impreglon UK. Contact us on +44(0)1827 871400 to find out more.
applications forfood productioncoatingsmachinery
https://federalgovernmentjobs.us/job-search/production-machinery-mechanic-5350.html?Sort=LC&dr=a&ps=100
Production Machinery Mechanic Jobs
Production Machinery Mechanic Jobs
production machinerymechanicjobs
https://www.qhsmt.com/tag/electronics-production-machinery/
electronics production machinery - Smt pick and place machine, Stencil Printer, Reflow Oven...
pick and placeelectronics production
https://www.sanborn.cz/en/industry/production-machinery-and-equipment
Production machinery and equipment | SANBORN
We produce precise and complex parts for leading manufacturers of CNC machines, microscopes and plastic moulds, among others. A large proportion of parts for...
machinery and equipmentproductionsanborn
https://bankruptcyauctionsales.com/ad-tag/wp-kemper-mini-quadro-round-bread-production-machinery/
Wp Kemper Mini Quadro Round bread production machinery | Bankruptcy Auction Sales
production machinerywpkemperminiquadro
https://www.plastemart.com/plastic-bag-making-pipe-socketing-machines/478
Post Production Machinery, Downstream Plastic Processing Equipment
Manufacturers of downstream plastic processing equipment and post production plastic machinery
post productionplastic processingmachinerydownstreamequipment
https://www.penhuipress.com/tag/tag_id/876502,876599,876537/
Production Machinery Anhui Province, China | Maanshan Penghui Heavy Industry Machinery Technologies...
Maanshan Penghui Heavy Industry Machinery Technologies Co. Ltd - Production Machinery Anhui Province, China , Maanshan Penghui Heavy Industry Machinery...
production machineryanhui provinceheavy industrychinamaanshan
https://www.paperpulpmachine.com/tissue-paper-making-cases/toilet-tissue-paper-roll-production-machinery-making-project-in-paper-mill/
Toilet Tissue Paper Roll Production Machinery Making Project In Paper Mill
tissue paper rollproduction machinerytoiletmakingproject
https://www.machineyingyee.com/news/ibrmakingmachine-20765.html
Innovative IBR Production Machinery for Enhanced Efficiency and Quality
Innovative IBR Production Machinery for Enhanced Efficiency and Quality whosale Manufacturer. We Offer Competitive Price As You Request for . On Time Delivery....
production machineryinnovativeibrenhancedefficiency
https://researchportal.port.ac.uk/en/publications/a-framework-for-the-automatic-programming-of-advanced-production-/
A framework for the automatic programming of advanced production machinery - University of...
for theautomatic programmingproduction machineryframework
https://www.penhuipress.com/tag/tag_id/876502,978819,876543/
Production Machinery Anhui Province, China | Maanshan Penghui Heavy Industry Machinery Technologies...
Maanshan Penghui Heavy Industry Machinery Technologies Co. Ltd - Production Machinery Anhui Province, China , Maanshan Penghui Heavy Industry Machinery...
production machineryanhui provinceheavy industrychinamaanshan
https://www.noahandthewhale.com/breakfast-50076193-food-production-machinery-breakfast-cereal-process-line-corn-flake.html
food production machinery/Breakfast Cereal Process Line, corn flake
Potato chip production line has different types of food production machinery/Breakfast Cereal Process Line, corn flake ,Wholesale Various High Quality Corn...
food productionbreakfast cerealmachineryprocessline
https://www.bevermac.com/index.php
BeverMac | Production Machinery - Reliable and Durable
Our company is an expert in the production of beverage filling machines, and we use the latest technologies to manufacture high-quality and reliable machines....
production machineryreliabledurable
https://hilcoindustrial.com/ja/lot/complete-stainless-steel-cold-rolling-facility-production-machinery-co-annealing-and-pickling-lines-hot-and-cold-a03rk00000hjz0piax
2x Production Machinery Co. Annealing & Pickling Lines
production machinerycoannealingpicklinglines
https://wb6net4vet.net/partnerships/cooperative-training-for-industrial-mechatronics-and-production-machinery-ohrid-2021/
Cooperative training for industrial mechatronics and production machinery Ohrid 2021 - Net4VET
The support the procurement of new modern equipment for mechatronics workshop, mechanical engineering workshop, PLC workshop and CNC workshop for student...
cooperative trainingfor industrialproduction machinerymechatronics
https://federalgovernmentjobs.us/job-search/production-machinery-mechanic-5350.html?Sort=LC&dr=d
Production Machinery Mechanic Jobs
Production Machinery Mechanic Jobs
production machinerymechanicjobs
https://accurateengineersindia.com/tag/tape-production-machinery/
Tape Production Machinery Archives - Accurate Engineers
production machinerytapearchivesaccurateengineers
https://www.emergenresearch.com/request-free-sample/170361
Request Free Sample-Sucrose Production Machinery Market
In-depth market research reports, insights, and consulting by Emergen Research.
request free sampleproduction machinerysucrosemarket
https://www.shoes-machine.com/productinfo/824548.html?templateId=195326
Leather Production Machinery Leather Area Measuring Leather Measuring Machine-Guangdong Dafeng Shoe...
Leather Production Machinery Leather Area Measuring Leather Measuring Machine
leather productionmachineryareameasuringguangdong
https://www.finol.ie/news/maximise-farm-production/
Increase Farm Production | Machinery Maintenance Tips | Agri Oils
Aug 7, 2025 - Increase your farm production with high-quality agri oils and take your business to new heights. Read this article to learn how to...
production machinerymaintenance tipsincreasefarmagri
https://digital.library.lse.ac.uk/Documents/Detail/report-on-the-census-of-production-for-1968.-part-50.-agricultural-machinery-except-tractors/419447
Report on the Census of Production for 1968. Part 50. Agricultural Machinery (except tractors) -...
https://www.urbanpackline.com/a-revolutionizing-production-the-latest-in-capsule-making-equipment.html
Revolutionizing Production: the Latest in Capsule Making Equipment - Urban Machinery
Are you ready to revolutionize your production process? The latest in capsule making equipment is here to streamline and enhance your manufacturing operations....
the latestrevolutionizingproductioncapsulemaking
https://www.karvil.com/news/EV-battery-slurry-production.html
EV battery slurry production news - Shandong Karvil Machinery Technology Co., Ltd
EV battery slurry production - news, trade show and technical articles about EV battery slurry production manufacturers and products.
ev batteryslurryproductionnews
https://www.fjhaina.com/haina_diaper_machinery_honor/27.html
Haina Pull up Diaper Production Line CE Certificate_Haina Machinery Factory
Haina Pull up Diaper Production Line CE Certificate
pull up diaperproduction linece certificatemachineryfactory
https://www.cnzjmb.com/a-news-detergent-powder-plant-machinery-maximizing-efficiency-in-production.html
Detergent Powder Plant Machinery: Maximizing Efficiency in Production
Introduction: In the competitive world of manufacturing, efficiency is the key to success.
detergent powdermaximizing efficiencyplantmachineryproduction
https://kruto-machinery.en.made-in-china.com/product-group/YbFAHWBrZzUN/PP-Board-Production-Line-1.html
PP Board Production Line - Qingdao Kruto Machinery Co.,Ltd. - page 1.
China PP Board Production Line catalog of PP Corrugated Hollow Sheet Extrusion Making Machine, Plastic Thick Board PP Sheet Extrusion Machine provided by China...
production lineppboardqingdao
https://single-bookmark.com/story20304946/automated-shade-net-production-industrial-grade-machinery-machinery
Automated Shade Net Production: Industrial-Grade Machinery Machinery
shade netindustrial gradeautomatedproductionmachinery
https://www.meijin-machine.com/blog/bun-machine-boost-output
Bun Machine Production Line: How to Boost Bun Output by 50% - Zhengzhou Meijin Machinery Equipment...
Our Bun Machine Will Have Your Production Flow Running Smoothly Do you want to bring your bun yield up by 50%? Just turn to the bun machine production line...
https://new-klima.pl/en/production-machinery-service/
Production machinery service - NEW KLIMA Sp. z o. o.
production machineryservicenewklimasp
https://www.xinda-machinery.com/category/products
Products - Xinda Machinery_PVC foam board production line_PVC marble sheet making machine_PVC...
pvc foam board
https://www.isweetech.com/confectionery-production-lines/candy-production-lines/lollipops-production-lines/
Lollipops Production Lines - Confectionery Production Line Solution and Machinery | iSweetech
production lineslollipopsconfectionerysolutionmachinery
https://www.anda-machine.com/product/sjsz65132-pvc-window-profile-production-line.html
SJSZ65/132 PVC window profile production line from China manufacturer - Anda Machinery Co., Ltd.
SJSZ65/132 PVC window profile production line offered by China manufacturer Anda Machinery Co., Ltd.. Buy SJSZ65/132 PVC window profile production line...
https://www.chinasupplierlist.com/textiles-leather-products/textile-leather-machinery/leather-production-machinery-parts.html
Leather Production Machinery Parts - China Leather Production Machinery Parts Suppliers
leather productionmachinery partschinasuppliers
https://www.rcmc.com/equip/details.php?id=138
Rubber City Machinery Corporation Production Mill STD84
rubbercitymachinerycorporationproduction
https://www.isweetech.com/production_lines/deposited-toffee-production-line-gdt/
GDT Series Deposited Toffee Production Line - Confectionery Production Line Solution and Machinery...
production linegdtseriesdepositedtoffee
https://www.nonwovenline.com/S-non-woven-production-lines/nonwoven-fabric-machinery-manufacturer
Nonwoven Fabric Machinery for Efficient Production - Yanpeng
Yanpeng is a leading manufacturer in China for nonwoven production line, spunbond nonwoven making machine, and nonwoven making machine.
nonwovenfabricmachineryefficientproduction
https://www.longreeimplements.com/specializing-in-the-production-and-sale-of-agricultural-machinery-equipment-light-chain-drive-rotary/
OEM Specializing in the production and sale of agricultural machinery equipment, light chain drive...
Discover high-quality agricultural machinery, including our light chain drive rotary tillers. Boost your farming efficiency with reliable equipment!
https://www.ypnonwoven.com/content/ssms-spunmelt-production-line/
SSMS Spunmelt Production Line - Zhejiang Yanpeng Nonwoven Machinery Co., Ltd
Zhejiang Yanpeng Nonwoven Machinery Co., Ltd. held a staff meeting in November, which explained the relevant plans for the production of nonwoven equipment in...
production linenonwoven machineryssmszhejiangco
https://gondormachinery.com/product/tomato-paste-production-line/
Tomato Paste Production Line - Gondor Machinery
Gondor automated tomato paste production line washes, crushes, preheats, pulps, and concentrates fresh tomatoes, followed by sterilization and precision...
tomato pasteproduction linegondormachinery
https://www.sansenplywoodmachine.com/china-complete-veneer-and-shuttering-plywood-making-machinery-veneer-production-line-press-machinery-for-sale_p82.html
China Top Brand China Complete Veneer And Shuttering Plywood Making Machinery /veneer Production...
We are Specialized China Complete Veneer and Shuttering Plywood Making Machinery /veneer production line /press machinery for sale suppliers in China,supply...
top brandshuttering plywoodchinacompleteveneer
https://m.massalfa.org/china-50010487-the-ld-2014-tofu-machinery-wholesale-tofu-machinery-tofu-production-line.html
The LD 2014 Tofu machinery wholesale tofu machinery tofu production line
Find the discount The LD 2014 Tofu machinery wholesale tofu machinery tofu production line online you need . We offer ... If you check out our large Massalfa...
ldtofumachinerywholesaleproduction
https://en.baofeng.net.cn/product/37/
Production Equipment_Plant Equipment_Dalian Baofeng Machinery Manufacturing Group Co.,Ltd.-Rubber...
Production Equipment-Dalian Baofeng Machinery Manufacturing Group Co.,Ltd.-Rubber Equipment-Centrifugal Roll
production equipmentmachinery manufacturingplantdalianbaofeng
https://www.jwellplast.com/sheet/48.html
PC wave plate Extrusion production line _Sheet&Plate Extrusion Machine_Products_Jwell Machinery...
Garden, recreation place, decoration and the corridor pavilion Internal and external ornaments in
production linepcwaveplateextrusion
https://www.moldedpulpmachine.com/tag/egg-carton-production-line
egg carton production line - Hunan Shuanghuan Fiber Molding Machinery Co.,Ltd
Hunan Shuanghuan Fiber Molding Machinery Co.,Ltd have a wide variety of products such as thermoforming machine, egg tray machine,molded fiber...
egg cartonproduction linehunan
https://www.fordaq.com/Price/Ty_S-Pc_103-L0_3794-L1_3987-L2_4005/Jobs---Training-periods-Permanent-Position-Production-Wood-machinery.html?cs=94
Permanent Position Forestry Job Production Forestry Job Wood Machinery Forestry Job Offers Germany
Permanent Position Forestry Job Production Forestry Job Wood Machinery Forestry Job Offers Germany, If You Want To Find Jobs In The Forestry Field, Fordaq Is...
production woodpermanentpositionforestryjob
https://en.degongmachinery.cn/news_details/28.html
Solution to drying problems in particleboard production line-Linyi Degong Machinery Co., Ltd.
In addition to the above issues, there are also other problems with the particleboard production line.
https://orient-machine.en.made-in-china.com/product-group/YqdTafOXnurw/Soy-protein-production-line-catalog-1.html
Soy protein production line - Jinan Orient Machinery & Equipment Co., Ltd. - page 1.
China Soy protein production line catalog of Textured Soy Nugget Chunks Protein Making Equipment Machine, Textured Soy Protein/Soya Nuggets/Soya Meat/Soy...
soy proteinproduction line
https://www.yjing-extrusion.com/how-does-extrusion-machinery-and-amp-improve-production-efficiency.html
How Does Extrusion Machinery And Amp Improve Production Efficiency? - YeJing Machinery
YeJing Machinery is a professional Extrusion Machinery and Amp, Extrusion Equipment, Plastic Extrusion Machinery China manufacturers, manufacturing company and...
production efficiencyextrusionmachineryampimprove
https://www.dasanjiang.biz/
Noodle Making Machines & Noodle Production Lines | Da SanJiang Machinery Co. Ltd.
Da SanJiang Machinery Co. Ltd. is a manufacturer of the Maggi compatible instant noodle making machine for processing fried, dry, and fresh ramen, as well as...
production linesnoodlemakingmachinesda
https://www.sfsue.com/others/bopp-adhesive-tape-production-line-slitting-cutting-rewinding-machine
BOPP Adhesive Tape Production Line Slitting Cutting Rewinding Machine - ZHEJIANG LIFENG MACHINERY...
BOPP Adhesive Tape Production Line Slitting Cutting Rewinding Machine
adhesive tapeproduction line
https://imsindustrial.co.uk/
Industrial Maintenance Services Ltd, Portsmouth | Production Machinery and Facilities Maintenance
industrial maintenanceproduction machineryservicesltdportsmouth
https://www.zlzsen.com/product/ice-making-series.html
Food Processing Machinery, Frying Machines & Snack Production Lines
Discover the full range of Qingdao Zlzsen food processing equipment, including frying machines, French fries production lines, potato chips production lines,...
food processing machineryfryingmachinessnackproduction
https://hnjoyshine.com/
French freis production line|Potato chips production line|Joyshine machinery
production linepotato chipsfrenchmachinery
https://haochenkeji.en.made-in-china.com/product/hAWRtbwTqJrD/China-Premium-Durable-Steel-Pipe-Production-Machinery-for-Global-Markets.html
Premium Durable Steel Pipe Production Machinery for Global Markets - Painting Line and Painting...
Premium Durable Steel Pipe Production Machinery for Global Markets, Find Details and Price about Painting Line Painting Production Line from Premium Durable...
steel pipeproduction machinery
https://www.senieer.com/improving-pharmaceutical-production-efficiency-with-advanced-machinery/
Improving Pharmaceutical Production Efficiency with Advanced Machinery - Senieer - What You Trust
Mar 20, 2025 - The pharmaceutical industry is facing increased pressure to improve production efficiency and reduce costs while maintaining high levels of quality and safety....
pharmaceutical productionadvanced machineryimprovingefficiency
https://www.zhenjiamachine.com/how-to-integrate-hf-welding-into-your-production-line/
How to Integrate HF Welding Into Your Production Line- Foshan Zhenjia Machinery Co., Ltd
May 6, 2026 - An automatic high frequency welding machine removes those manual steps from the critical path. It feeds, positions, welds, cools, and ejects parts in a...
how to integrate
https://yongshunfa.en.made-in-china.com/product/ysfEdbRkAVWr/China-Stainless-Steel-Tube-Making-Machinery-Square-Round-Tube-Mill-Pipe-Machine-Pipe-Production-Line.html
Stainless Steel Tube Making Machinery Square & Round Tube Mill Pipe Machine Pipe Production Line -...
stainless steel
https://www.xinda-machinery.com/category/profile-production-line/pvc-marble-profile-line
PVC marble profile line - Xinda Machinery_PVC foam board production line_PVC marble sheet making...
PVC marble profile line
foam boardpvcmarbleprofileline
https://www.cnwffm.com/Molding-flask-and-boxes-for-production-line-pd6964315.html
Molding flask and boxes for production line from China manufacturer - Weifang foundry machinery
Molding flask and boxes for production line offered by China manufacturer Weifang foundry machinery. Buy Molding flask and boxes for production line directly...
https://www.yjing-extrusion.com/how-to-choose-the-best-extrusion-moulding-equipment-for-your-production-needs.html
How To Choose The Best Extrusion Moulding Equipment for Your Production Needs? - YeJing Machinery
YeJing Machinery is a professional Extrusion Moulding Equipment, Plastic Extrusion Moulding, Extrusion Molding Machine China manufacturers, manufacturing...
how to choose the
https://www.weishumachinery.com/application/yogurt-production-line-equipment
Yogurt production line equipment Manufacturer & Supplier in China - Weishu Intelligent Machinery...
production lineequipment manufactureryogurt
https://en.xuelongqiye.com/products_details/14.html
Automatic packaging molding machine-Xuelong Machinery | Foam machine | EPS production line
Automatic packaging molding machine The research and development of automatic packaging molding machine breaks through the traditional operation mode, making...
automaticpackagingmoldingmachinefoam
https://digital.library.lse.ac.uk/Documents/Detail/report-on-the-census-of-production-for-1974-and-75.-pa339.7-food-and-drink-processing-machinery-and-packaging-and-bottling-machinery/434950
Report on the Census of Production for 1974 and 75. PA339.7 Food and drink processing machinery and...
https://www.1dfoodmachine.com/jhh-50137397-peanut-roaster-machinery-peanut-brittle-production-line.html
peanut roaster machinery/peanut brittle production line
peanut roaster machinery/peanut brittle production line is one needed matching equipment of the Bean/Nut Roaster Machine,which is suitable for the granular oil...
peanutroastermachinerybrittleproduction
https://www.hrcusa.org/pic-51328762.html
Jinan Crispy Corn Puff Snack Machine Production Line - Small Oil Pressing Machine - Leader Machinery
Jinan Crispy Corn Puff Snack Machine Production Line Industries and Applications ? 39 mm B C3 Radial clearance class We sell discount puff snack production...
https://qdbesttech.en.made-in-china.com/product-group/IMlEVpeyOURn/Resin-Green-sand-production-plant-catalog-1.html
Resin / Green sand production plant - Qingdao Bestech Machinery Co., Ltd. - page 1.
China Resin / Green sand production plant catalog of China Foundry Factory Supply Technology Matures Resin Sand Reclamation and Molding Line, The Resin Sand...
production plant
https://textilemachinery.en.made-in-china.com/product-group/DblJOInyJRpa/Coconut-Coir-Mattress-Production-Line-1.html
Coconut Coir Mattress Production Line - Qingdao Huarui Jiahe Machinery Co., Ltd. - page 1.
China Coconut Coir Mattress Production Line catalog of Coconut Coir Mattress Machine Production Line / Nonwoven Fabric Mattress Coconut Coir Palm Fiber Bamboo...
https://www.glassglobal.com/company-directory/2-8-31-51-2.html
Press and Blow Machines - Machines - Production Machines - Moulds - Supplier / Machinery - glass...
Bucher Emhart Glass,Waltec Maschinen GmbH,Heye International GmbH,Shandong Sanjin Glass Machinery Co., Ltd,Siegler Hohlglasservice,Obrien Industries (Pvt)...
pressblowmachinesproductionmoulds
https://www.pvcflooringmc.com/Luxury-Vinyl-Tile-Production-Machinery.html
Luxury Vinyl Tile Production Machinery
PVC Floor Machine,lvt floor machine ,Luxury Vinyl Tile Production Machinery,
luxury vinyl tileproductionmachinery
https://www.chinepack.com/en/line/lolipop
PRODUCTION LINE | LOLIPOP PRODUCTION LINE-chinepack food machinery
production linelolipopfoodmachinery
https://7prbookmarks.com/story20312855/automated-shade-net-production-industrial-grade-machinery-machinery
Automated Shade Net Production: Industrial-Grade Machinery Machinery
shade netindustrial gradeautomatedproductionmachinery
https://ljfoodmachine.en.made-in-china.com/product-group/JegxGDXARYpq/Others-Fried-Food-Production-Line-1.html
Others Fried Food Production Line - Zhucheng Lijie Food Machinery Co.,Ltd. - page 1.
China Others Fried Food Production Line catalog of Lj-500 Gooseberry Washing and Dewatering Machine, Industrial Washing and Dewatering Machine for Raspberry...
fried foodproduction line
https://www.noahandthewhale.com/fish-50080812-turnkey-dry-pet-food-machinery-production-line.html
turnkey dry pet food machinery/production line
Pet Food / Fish Feed Production Line endues pet food with the amount of nutrition, digestible structure, novel shape, and unique taste to meet with the needs...
dry pet foodmachinery productionturnkeyline
https://www.anda-machine.com/product/sjsz65132-pvc-window-profile-production-line-763.html
SJSZ65/132 PVC window profile production line from China manufacturer - Anda Machinery Co., Ltd.
SJSZ65/132 PVC window profile production line offered by China manufacturer Anda Machinery Co., Ltd.. Buy SJSZ65/132 PVC window profile production line...
https://www.stewarts-group.com/taking-delivery-of-new-state-of-the-art-machinery-at-our-production-facility/
Taking delivery of new state-of-the-art machinery at our Production Facility - Stewarts Group
Jun 23, 2020 - Stewarts have taken delivery of a new, state-of-the-art Quick Turn 200 CNC Turning Centre at our production facility at Kilsyth near Glasgow, Scotland.