Robuta

https://mjperry.blogspot.com/2009/02/cultural-and-social-effects-of.html CARPE DIEM: The Cultural and Social Effects of Recessions carpe diemthe culturaland socialeffectsrecessions https://www.fool.com/investing/stock-market/basics/what-is-a-recession/ Recessions: Definition, Causes & More | The Motley Fool May 30, 2025 - Take a closer look at what a recession is, what to expect, and things that might indicate a recession is coming. the motleyrecessionsdefinitioncausesfool https://repository.law.upenn.edu/Documents/Detail/recessions-and-the-social-safety-net-the-alternative-minimum-tax-as-a-countercyclical-fiscal-stabilizer/392132 Recessions and the Social Safety Net: The Alternative Minimum Tax as a CounterCyclical Fiscal... social safety netalternative minimum tax https://pubmed.ncbi.nlm.nih.gov/28901687/ Treatment of multiple maxillary adjacent class I and II gingival recessions with modified coronally... The modified coronally advanced tunnel technique using the new porcine acellular dermal matrix represents a clinically and esthetically satisfactory treatment... https://pmc.ncbi.nlm.nih.gov/articles/PMC11108902/ Adjunctive use of hyaluronic acid in the treatment of gingival recessions: a systematic review and... To explore the efficacy of Hyaluronic acid as an adjunctive in treatment of gingival recessions (GR). A systematic literature search was performed in several... https://freedominourtime.blogspot.com/2009/03/remembrance-of-recessions-past.html?showComment=1238710560000 Pro Libertate: Remembrance of Recessions Past The greatest man I will ever know: My father, L. Richard Grigg, holding his grandson, Jefferson Leonidas Grigg (age 3 at the time), circa 20... prolibertateremembrancerecessionspast https://freedominourtime.blogspot.com/2009/03/remembrance-of-recessions-past.html?showComment=1237542540000 Pro Libertate: Remembrance of Recessions Past The greatest man I will ever know: My father, L. Richard Grigg, holding his grandson, Jefferson Leonidas Grigg (age 3 at the time), circa 20... prolibertateremembrancerecessionspast https://www.recessionsdc.com/ Bar | Recessions | Washington Recessions is a bar located in Downtown Washington filled with games, karaoke, and good people. barrecessionswashington https://freedominourtime.blogspot.com/2009/03/remembrance-of-recessions-past.html?showComment=1237517580000 Pro Libertate: Remembrance of Recessions Past The greatest man I will ever know: My father, L. Richard Grigg, holding his grandson, Jefferson Leonidas Grigg (age 3 at the time), circa 20... prolibertateremembrancerecessionspast https://econospeak.blogspot.com/2013/10/nber-recessions-vs-actual-recessions_4.html EconoSpeak: NBER Recessions vs. Actual Recessions? (part 2 of 2) nberrecessionsvsactualpart https://econospeak.blogspot.com/2011/05/those-pesky-postwar-recessions.html?showComment=1304438121362 EconoSpeak: Those Pesky Postwar Recessions peskypostwarrecessions https://sites.libsyn.com/59382/murphy-takes-on-krugman-on-recessions-business-cycles The Tom Woods Show : Ep. 367 Murphy Takes on Krugman on Recessions, Business Cycles the tom woods show https://www.stlouisfed.org/on-the-economy/2020/november/recessions-impact-household-net-worth How Recessions Impact Household Net Worth | St. Louis Fed Household net worth recovery for the least wealthy was most uneven net worthst louisrecessionsimpacthousehold https://www.sciencedaily.com/releases/2014/09/140929154553.htm Recessions result in lower birth rates in the long run | ScienceDaily While it is largely understood that birth rates plummet when unemployment rates soar, the long-term effects have never been clear. Now, new research shows that... the long runbirth ratesrecessionsresultlower https://econospeak.blogspot.com/2011/05/those-pesky-postwar-recessions.html?showComment=1304434090946 EconoSpeak: Those Pesky Postwar Recessions peskypostwarrecessions https://takingcareofbusiness.buzzsprout.com/1773229/episodes/11563772-recessions-and-today-s-economy-what-it-means-for-you Recessions and today's economy - What it means for you On this episode of Taking Care of Business, Paul Cheetham-Karcz sits down with leading behavioural economist Roger Martin-Fagg to discuss the current economic... what it meansrecessionstodayeconomy https://recessionskaraoke.vercel.app/ Home - Recessions DC Karaoke song request app with QR code for Recessions DC recessionsdc https://econospeak.blogspot.com/2011/05/those-pesky-postwar-recessions.html?showComment=1304458741717 EconoSpeak: Those Pesky Postwar Recessions peskypostwarrecessions https://mrzepczynski.blogspot.com/2022/03/commodity-oil-supply-shocks-and.html Disciplined Systematic Global Macro Views: Commodity oil supply shocks and recessions Global macro, systematic investing, alternative risk premia global macrooil supplydisciplinedsystematicviews https://stefanmikarlsson.blogspot.com/2009/01/recessions-good-times-for-new.html Stefan Karlsson's blog: Recessions-Good Times For New Businesses? s bloggood timesfor newstefankarlsson https://caveatbettor.blogspot.com/2007/01/recessions-of-2003-2004-2006-2006.html Caveat Bettor: The Recessions of 2003, 2004, 2006 & 2006 From today's WSJ (subscription required): Meanwhile, back at the economy, you may have noticed that 2006 ended without a recession. This fo... caveatbettorrecessions https://boris-portal.unibe.ch/entities/publication/5afeea7d-942d-4c0f-9f97-0c10bb00404e Use of platelet-rich fibrin for the treatment of gingival recessions: a systematic review and... OBJECTIVES The aim of this systematic review and meta-analysis was to compare the use of platelet-rich fibrin (PRF) with other commonly utilized treatment... https://mpra.ub.uni-muenchen.de/60300/ Regional recessions and recoveries in theory and practice: a resilience-based overview Munich... in theory https://ideas.repec.org/a/ags/jrapmc/339973.html The Great, Greater, and Greatest Recessions of US States Downloadable! This paper examines state-level differences in the timing, depth, and total employment effects of the Great Recession. It finds that several... the greatgreatergreatestrecessionsus https://fredblog.stlouisfed.org/2017/04/not-all-recessions-are-created-equal/ Not all recessions are created equal | FRED Blog created equalrecessionsfredblog https://econospeak.blogspot.com/2011/05/those-pesky-postwar-recessions.html?showComment=1304529467465 EconoSpeak: Those Pesky Postwar Recessions peskypostwarrecessions https://econospeak.blogspot.com/2014/12/monetary-policy-during-1974-and-1982.html EconoSpeak: Monetary Policy During the 1974 and 1982 Recessions monetary policyrecessions https://recessionskaraoke.vercel.app/new-song-request Recessions Karaoke Karaoke song request app with QR code for Recessions DC recessionskaraoke https://www.econ.ku.dk/Kalender/seminarerepru/23112012/ Katarina Juselius, University of Copenhagen: "Balance sheet recessions and time-varying... university of copenhagenbalance sheetkatarina https://www.fool.com/investing/2023/05/14/looking-for-safe-income-this-stock-raised-its-divi/ Looking for Safe Income? This Stock Raised Its Dividend in the Last 3 Recessions. | The Motley Fool May 14, 2023 - This real estate investment trust has raised its dividend for nearly 30 consecutive years. https://www.bain.com/es-co/insights/marketing-in-asia-lessons-from-recessions-past/ Marketing in Asia: lessons from recessions past | Bain & Company Aug 20, 2018 - Asia's fast-growing emerging markets have been good to multinational consumer-product trailblazers. in asiamarketinglessonsrecessionspast https://ideas.repec.org/a/jae/japmet/v20y2005i2p291-309.html Nonlinearity and the permanent effects of recessions Downloadable! This paper presents a new nonlinear time series model that captures a post-recession 'bounce-back' in the level of aggregate output. While a... and thenonlinearitypermanenteffectsrecessions https://abca.dc.gov/publication/recessions-ii-august-26-2021-board-order Recessions II - August 26, 2021 - Board Order | abra Recessions II - Order Vacating Cancellation of License and Reinstating License recessionsiiaugustboardorder https://gwipp.gwu.edu/national-grants-system-and-cities-during-great-recessions-drawing-lessons-cross-national-analysis National Grants System and Cities During the Great Recessions: Drawing Lessons from a... The project examined the ways in which national grant systems have met the needs of city governments in the United States https://www.nber.org/papers/w19443 Paradox of Thrift Recessions | NBER Founded in 1920, the NBER is a private, non-profit, non-partisan organization dedicated to conducting economic research and to disseminating research findings... paradox of thriftrecessionsnber https://ideas.repec.org/p/cpr/ceprdp/6937.html Oil Prices, Profits, and Recessions: An Inquiry Using Terrorism as an Instrumental Variable Downloadable! Nearly all post-war recessions were preceded by oil-price shocks, but is this because spikes in the price of oil cause economic downturns? At the... oil prices https://www.hks.harvard.edu/centers/mrcbg/programs/growthpolicy/strengthening-safety-net-mitigate-effect-future-recessions Strengthening the Safety Net to Mitigate the Effect of Future Recessions | Harvard Kennedy School Strengthening the Safety Net to Mitigate the Effect of Future Recessions. Lawrence Summers, May 2016, Video, "The Hamilton Project at Brookings - Conference... the safety net https://econpapers.repec.org/paper/pramprapa/13911.htm EconPapers: Predicting European Union recessions in the euro era: The yield curve as a forecasting... By Periklis Gogas, Dionysios Chionis and Ioannis Pragkidis; Abstract: Several studies have established the predictive power of the yield curve, ie: the... https://www.gsb.stanford.edu/insights/how-ease-pain-mass-layoffs-during-recessions How to Ease the Pain of Mass Layoffs During Recessions | Stanford Graduate School of Business Government programs to save jobs are costly. But avoiding the scarring effects of unemployment can be worth it. https://e-forecasting.com/ index page of e-forecasting offering U.S. monthly GDP and recessions, U.S. economic leading... Index page of e-forecasting offering U.S. monthly GDP and recessions, U.S. economic leading analytics and U.S. consumere confidence https://ideas.repec.org/p/fip/fedhma/92-7.html A procedure for predicting recessions with leading indicators: econometric issues and recent... No abstract is available for this item. https://theweek.com/articles/929715/age-discrimination-rises-recessions Age discrimination rises in recessions | The Week Aug 8, 2020 - And more of the week's best financial insight age discriminationrisesrecessionsweek https://www.imf.org/en/blogs/articles/2018/03/21/the-economic-scars-of-crises-and-recessions?path=Blogs%2CArticles%2C2018%2C03%2C21%2Cthe-economic-scars-of-crises-and-recessions The Economic Scars of Crises and Recessions economicscarscrisesrecessions https://www.bls.gov/opub/ted/2014/ted_20140808.htm Leisure and hospitality employment during recent recessions : The Economics Daily : U.S. Bureau of... leisure and hospitality https://www.weforum.org/stories/2018/08/this-swedish-city-has-cut-emissions-at-rates-only-seen-after-economic-crashes-recessions-or-war-and-its-thriving/ This Swedish city has cut emissions at rates only seen after economic crashes, recessions or war.... Ringed by forests in southern Sweden, the city of Vaxjo is thriving even as it cuts greenhouse gas emissions by almost 60%. https://mainlymacro.blogspot.com/2017/07/why-recessions-followed-by-austerity.html mainly macro: Why recessions followed by austerity can have a persistent impact Economics students are taught from an early age that in the short run aggregate demand matters, but in the long run output is determined fr... mainly macrofollowed by https://boris-portal.unibe.ch/entities/publication/7dabceba-303a-49cb-992b-449847a78cb1 Development of labial gingival recessions in orthodontically treated patients INTRODUCTION Our aim was to assess the prevalence of gingival recessions in patients before, immediately after, and 2 and 5 years after orthodontic treatment.... developmentlabialgingivalrecessionstreated https://politicalcalculations.blogspot.com/2012/02/using-miles-to-measure-recessions.html Political Calculations: Using Miles to Measure Recessions political calculationsusingmilesmeasurerecessions https://pubmed.ncbi.nlm.nih.gov/26878749/ Long-Term Outcomes of Untreated Buccal Gingival Recessions: A Systematic Review and Meta-Analysis Untreated recession defects in individuals with good oral hygiene have a high probability of progressing during long-term follow-up. https://pro.thestreet.com/investing/top-3-high-yield-dividend-kings-can-withstand-the-worst-recessions Top 3 High-Yield Dividend Kings Can Withstand the Worst Recessions | TheStreet Pro These three names have made an elite list of dividend stocks and should continue to raise them for years to come. https://www.brookings.edu/events/law-and-macroeconomics-using-regulations-to-combat-recessions/ Law and macroeconomics: Using regulations to combat recessions | Brookings Sep 13, 2019 - On Tuesday, September 10, at an Urban-Brookings Tax Policy Center event, Yair Listokin presented the key findings of his research, and panelists deepened the... lawmacroeconomicsusingregulationscombat https://www.pymnts.com/tag/recessions/ recessions Archives | PYMNTS.com recessionsarchivespymnts https://economics.princeton.edu/events/the-matching-multiplier-and-the-amplification-of-recessions/ The Matching Multiplier and the Amplification of Recessions - Princeton University - Department of... princeton universitymatchingmultiplieramplificationrecessions https://www.goldmansachs.com/insights/articles/us-president-incumbents-tend-to-win-elections-except-during-recessions.html?chl=em&plt=briefings&cid=1208&plc=body?chl=em&plt=briefings&cid=1208&plc=body Incumbent US presidents tend to win elections except during recessions | Goldman Sachs us presidentsto win https://ibdst.blogspot.com/2019/05/fact-check-truth-about-recessions.html UNDIEPUNDIT.COM: Fact Check: The Truth About Recessions [UPDATED] Unique perspectives in economics, politics, humor, and whatever else interests me. the truth aboutfact checkrecessionsupdated https://rotmaniib.blogspot.com/2009/10/demons-dragons-and-eclipsing-recessions.html Institute for International Business Blog: Demons, Dragons and Eclipsing Recessions Many ancient cultures believed that solar eclipses were the result of a dragon or some other demon trying to devour the sun. Since the loss... for international businessinstituteblogdemonsdragons https://macromarketmusings.blogspot.com/2013/05/balance-sheet-recessions-are-really.html?m=1 Macro Musings Blog: Balance Sheet Recessions Are Really Nominal Income Recessions I recently lamented the Fed's ongoing dereliction of duty as seen in the sustained declined of households' expected nominal income growth:... macro musingsbalance sheetblogrecessionsreally https://freedominourtime.blogspot.com/2009/03/remembrance-of-recessions-past.html?m=0 Pro Libertate: Remembrance of Recessions Past The greatest man I will ever know: My father, L. Richard Grigg, holding his grandson, Jefferson Leonidas Grigg (age 3 at the time), circa 20... prolibertateremembrancerecessionspast https://recessionskaraoke.vercel.app/login Login - Recessions DC Karaoke song request app with QR code for Recessions DC recessionsdc https://arkansasgopwing.blogspot.com/2011/08/tale-of-two-recessions.html ARRA News Service: A Tale Of Two Recessions a tale of twonews servicearrarecessions https://pmc.ncbi.nlm.nih.gov/articles/PMC8625678/ Lost in recessions: youth employment and earnings in Spain - PMC Young workers in Spain face the unprecedented impact of the Great Recession and the COVID-19 crisis in short sequence. Moreover, they have also experienced a... employment and earningslostrecessionsyouthspain https://www.cato.org/blog/should-fed-raise-rates-now-combat-future-recessions Should the Fed Raise Rates Now to Combat Future Recessions? | Cato at Liberty Blog Jun 18, 2022 - If raising rates now will hurt the economy just as much as lowering them later will help, why is the net effect beneficial? https://pubmed.ncbi.nlm.nih.gov/32591868/ Use of platelet-rich fibrin for the treatment of gingival recessions: a systematic review and... The data indicate that the use of PRF in conjunction with CAF statistically significantly improves rRC when compared with CAF alone but did not improve KMW.... https://econospeak.blogspot.com/2016/09/all-models-are-false-internetcomputer.html?showComment=1474843366440 EconoSpeak: All Models are False: The Internet/Computer Explanation of Major Recessions all modelsthe internet https://economiclogic.blogspot.com/2011/08/convergence-in-recessions.html Economic Logic: Convergence in recessions Growth theory and data teach us that, at least in developed countries, economies tend to converge in the long run: the dispersion across reg... economiclogicconvergencerecessions https://ideas.repec.org/p/cpr/ceprdp/10786.html Pushing on a String: US Monetary Policy is Less Powerful in Recessions Downloadable (with restrictions)! We estimate the impulse response of key US macro series to the monetary policy shocks identified by Romer and Romer (2004),... on a stringmonetary policy https://markets.businessinsider.com/news/stocks/jeff-gundlach-best-quotes-on-markets-investing-recessions-and-bonds-2020-5-1029176225 Jeff Gundlach Best Quotes on Markets, Investing, Recessions, and Bonds - Markets Insider While Jeff Gundlach is known as bond king of the world, he is equally renowned for his views on markets, recessions, Warren Buffett and much more. best quotesjeffgundlach https://econpapers.repec.org/article/kapiaecre/v_3a16_3ay_3a2010_3ai_3a1_3ap_3a1-10_3a10.1007_2fs11294-009-9247-2.htm EconPapers: Predicting European Union Recessions in the Euro Era: The Yield Curve as a Forecasting... By Dionysios Chionis, Periklis Gogas and Ioannis Pragidis; Abstract: Several studies have established the predictive power of the yield curve for the U.S. and... https://macromusings.libsyn.com/dylan-matthews-on-nine-ways-to-prevent-future-recessions Macro Musings with David Beckworth: Dylan Matthews on Nine Ways to Prevent Future Recessions Dylan Matthews is a senior correspondent with Vox where he covers a wide array of topics including immigration policy, universal basic income, education... https://socialdemocracy21stcentury.blogspot.com/2011/12/us-recessions-of-1890s-in-balke-and.html?m=0 Social Democracy for the 21st Century: A Realist Alternative to the Modern Left: The US Recessions... Let us look at the estimates of Balke and Gordon for real US GNP for the 1890s, since that issue has been raised on comments on the previous... https://econospeak.blogspot.com/2011/05/those-pesky-postwar-recessions.html?showComment=1304425759571 EconoSpeak: Those Pesky Postwar Recessions peskypostwarrecessions https://ideas.repec.org/p/ces/ceswps/_5240.html Scars of Recessions in a Rigid Labor Market Downloadable! We study the impact of graduating in a recession in Flanders (Belgium), i.e. in a rigid labor market. In the presence of a high minimum wage, a... in ascarsrecessionsrigidlabor https://ideas.repec.org/b/spr/sprbok/978-3-642-20680-1.html Asset Prices, Booms and Recessions No abstract is available for this item. asset pricesboomsrecessions https://file.scirp.org/Html/5-7200432_29145.htm Competition Policy under Economic Recessions: Historical Changes and Implications competition policyeconomicrecessionshistoricalchanges https://managerialecon.blogspot.com/2008/10/recessions-coupled-with-housing-bust_6114.html Managerial Econ: Recessions coupled with a housing bust are twice as bad New research from Prakash Lougani, who teaches in our Exec MBA program: with a https://www.kellogg.northwestern.edu/academics-research/research/detail/2021/economic-recessions-and-congressional-preferences-for-redistribution/ Economic Recessions and Congressional Preferences for Redistribution | Kellogg School of Management We study if U.S. Members of Congress who experienced an economic recession during early adulthood vote differently on redistribution-specific bills. We find... school ofeconomicrecessionscongressionalpreferences https://macromarketmusings.blogspot.com/2008/03/predicting-recessions.html?m=1 Macro Musings Blog: Predicting Recessions Here is an interesting article given my own research interest . Financial Market Perceptions of Recession Risk Thomas B. King, Andrew T. Lev... macro musingsblogpredictingrecessions https://www.livescience.com/32565-do-recessions-increase-violent-crimes.html Do Recessions Increase Violent Crimes? | Live Science May 3, 2010 - There's a clear connection between bad economic conditions and crimes like burglaries and muggings, but the relationship between the recession and violent... violent crimesrecessionsincreaselivescience https://ideas.repec.org/p/pra/mprapa/112005.html The Great, Greater, and Greatest Recessions of US States Downloadable! This paper examines state-level differences in the effects of the Great Recession. It finds that several states were in recession prior to the... the greatgreatergreatestrecessionsus https://poverty.ucdavis.edu/research-paper/who-suffers-during-recessions Who Suffers During Recessions? - Center for Poverty and Inequality Research Hilary Hoynes (Affiliate in Economics), Douglas L. Miller (Affiliate in Economics) and Jessamyn Schaller (former graduate student in Economics, currently an... poverty and inequalitycenter forsuffersrecessionsresearch https://www.federalreserve.gov/econres/notes/feds-notes/non-financial-corporate-credit-and-recessions-20210319.html The Fed - Non-Financial Corporate Credit and Recessions The Federal Reserve Board of Governors in Washington DC. the fednon financialcorporate creditrecessions https://www.deloitte.com/lk/en/about/story/purpose-values/through-wars-recessions-and-pandemics-a-story-of-resilience.html Through wars, recessions, and pandemics: A story of resilience a storywarsrecessionspandemicsresilience