Robuta

https://www.bmus-ors.org/ BMUS: The Burden of Musculoskeletal Diseases in the United States | Prevalence, Societal and... Prevalence, Societal and Economic Cost the burdenmusculoskeletal diseasesunited statesprevalencesocietal https://www.mjhid.org/mjhid/article/view/2016.007/pdf_63 View of PREVALENCE OF HEPATITIS C AMONG EGYPTIAN CHILDREN WITH SICKLE CELL DISEASE AND THE ROLE OF... sickle cell diseaseviewprevalencehepatitisamong https://jlupub.ub.uni-giessen.de/items/faf97a9c-ebe0-4bbb-886f-35ff2dd7542b Prevalence and effects of Vitamin D receptor polymorphism on bone mineral density and metabolism in... Patients with systemic sclerosis (SSc) have a disproportionately high prevalence of reduced bone mineral density (BMD). Polymorphisms of the vitamin D receptor... bone mineral densityprevalenceeffectsvitaminreceptor https://uwcscholar.uwc.ac.za/items/5ac495c5-0bfe-47f1-b47d-1809a2389acf The prevalence of traditional herbal medicine use among hypertensives living in South African... BACKGROUND: In South Africa, over 6 million people are hypertensive and the burden of disease shows that cardiovascular diseases (CVDs) are the leading cause... herbal medicinesouth africanprevalencetraditionaluse https://pmc.ncbi.nlm.nih.gov/articles/PMC10843881/ Epidemiology of Stage IV Colorectal Cancer: Trends in the Incidence, Prevalence, Age Distribution,... Colorectal cancer is a common malignancy in men and women. Historically, stage IV colorectal cancer has 10 to 15% five-year survival. Developments in the... colorectal cancerepidemiologystageivtrends https://wjarr.com/content/prevalence-toxoplasmosis-antibodies-blood-donors-tripoli-area Prevalence of Toxoplasmosis antibodies in blood donors in Tripoli area Toxoplasma gondii is the organism that is responsible for toxoplasmosis disease. Toxoplasma gondii: is a crucial obligate intracellular parasite of humans and... blood donorsprevalencetoxoplasmosisantibodiestripoli https://researchoutput.csu.edu.au/en/publications/prevalence-of-communication-disorders-compared-with-other-learnin-2/ Prevalence of communication disorders compared with other learning needs in 14 500 primary and... communication disorderslearning needsprevalencecomparedprimary https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0085769 The Impact of Height during Childhood on the National Prevalence Rates of Overweight | PLOS One Background It is known that height and body mass index (BMI) are correlated in childhood. However, its impact on the (trend of) national prevalence rates of... the impactplos oneheightchildhoodnational https://journal.waocp.org/article_89311.html Prevalence of Human Polyomavirus JC and BK in Normal Population JC virus (JCV) , and BK virus (BKV) can remain latency in kidney and excrete via urine asymptomatically. JCV has been associated with colorectal and bladder... prevalencehumanjcbknormal https://research.ucc.ie/en/publications/prevalence-of-pks-bacteria-and-enterotoxigenic-bacteroides-fragil/ Prevalence of pks + bacteria and enterotoxigenic Bacteroides fragilis in patients with colorectal... in patientsprevalencepksbacteriacolorectal https://diposit.ub.edu/items/7c19381b-edae-48fb-ab13-59764cc9ee54 Prevalence of Mandibular Third Molar Impaction, Associated Pathologies, and Correlation With... Background Mandibular third molar is the most frequent impacted tooth in the oral cavity. Its presence can be associated with complications including the... prevalencethirdimpactionassociatedpathologies https://iris.uniupo.it/handle/11579/80075 Unexpectedly high prevalence of critic coronary artery disease in asymptomatic dialysis patients... coronary artery diseasehighprevalencecriticasymptomatic https://sure.sunderland.ac.uk/id/eprint/3181/ Prevalence of sedentary behaviour in young people in Romania and Slovakia - SURE sedentary behaviouryoung peopleprevalenceromaniaslovakia https://research.monash.edu/en/publications/global-regional-and-national-incidence-prevalence-and-years-lived-2/ Global, regional, and national incidence, prevalence, and years lived with disability for 310... globalregionalnationalincidenceprevalence https://dea.lib.unideb.hu/items/4a5ed995-0336-44b8-b578-7e1d1cb968cd Prevalence of Malnutrition Among Children in Nigeria This thesis is about the prevalence of malnutrition among children in Nigeria. It also talks about how insecurities, family planning, parental education,... in nigeriaprevalencemalnutritionamongchildren https://rivm.openrepository.com/entities/publication/e069c581-08aa-4179-8892-804fbc0a118c Prevalence and risk factors for Chlamydia trachomatis seropositivity and seropersistence among... Population-based Chlamydia trachomatis (CT) serology studies help evaluate the effectiveness of CT-control strategies. Determinants of CT seropersistence over... risk factorschlamydia trachomatisprevalenceamong https://www.celcis.org/news/news-pages/report-recognising-risks-and-prevalence-child-sexual-abuse-and-exploitation-scotland New report on recognising the risks and prevalence of Child Sexual Abuse and Exploitation published... A new report providing an overview of the prevalence of child sexual abuse and child sexual exploitation, and approaches to prevent and respond to the risk and... child sexual abusenew reportthe risksprevalenceexploitation https://archbronconeumol.org/en-estadisticas-S0300289623001631 Prevalence and Impact of Asthma and Allergy on Daily Life, Health Outcomes and Use of Healthcare... daily lifehealth outcomesprevalenceimpactasthma https://medicalsciencereview.com/index.php/Journal/article/view/839/929 View of A COMPREHENSIVE REVIEW OF THE PREVALENCE, DETERMINANTS, AND CHALLENGES OF SMALL-CELL LUNG... a comprehensive reviewsmall cellprevalencedeterminantschallenges https://cris.huji.ac.il/en/publications/prevalence-of-frailty-and-associations-with-oral-anticoagulant-pr-2/ Prevalence of Frailty and Associations with Oral Anticoagulant Prescribing in Atrial Fibrillation -... atrial fibrillationprevalencefrailtyassociationsoral https://pr.sdiarticle5.com/review-history/133367 Peer Review History: Prevalence and Length of the Mental Nerve Loop in an Indian Population Using... peer review historyloop inprevalencelengthmental https://ibis.utah.gov/epht-view/indicator/complete_profile/AsthAdltPrev.html UT-EPHT - Complete Health Indicator Report - Asthma: Adult Prevalence asthma, breathing, lung, bronchi complete healthutindicatorreportasthma https://www.econbiz.de/Record/study-the-differences-the-relationship-between-hiv-aids-prevalence-and-related-costs-the-mining-and-financial-sectors-south-africa-smit-stefan/10009442126 A study of the differences in the relationship between HIV/AIDS prevalence and related costs in the... ENGLISH ABSTRACT: By understanding the costs of HIV/AIDS, businesses can understand the incentives for preventing and treating the disease better. This report... a studyhiv aidsdifferencesrelationshipprevalence https://cris.continental.edu.pe/es/publications/the-global-prevalence-of-human-fascioliasis-a-systematic-review-a/ The global prevalence of human fascioliasis: a systematic review and meta-analysis - Universidad... a systematic reviewmeta analysisglobalprevalencehuman https://www.studiapolitologiczne.pl/Keyword-smoking+prevalence/65291 Studia Politologiczne - Keyword smoking prevalence studiakeywordsmokingprevalence https://www.ijmedrev.com/article_143555.html Prevalence and Diagnosis Method of Celiac Disease in Jordan: A Review Article Short Title: Celiac... The Celiac Disease (CD) is an autoimmune enteropathy triggered by dietary gluten in genetically susceptible individuals. CD is considered one of the... diagnosis methodceliac diseasereview articleshort titleprevalence https://pureportal.inbo.be/nl/publications/prevalence-of-fox-tapeworm-in-invasive-muskrats-in-flanders-north/publications/ Prevalence of Fox Tapeworm in Invasive Muskrats in Flanders (North Belgium) - Onderzoeksoutput -... prevalencefoxtapeworminvasivemuskrats https://cdc.gov/mmwr/preview/mmwrhtml/ss5601a1.htm Prevalence of Autism Spectrum Disorders --- Autism and Developmental Disabilities Monitoring... autism spectrum disordersdevelopmental disabilitiesprevalencemonitoring https://www.frontiersin.org/journals/oral-health/articles/10.3389/froh.2024.1461959/full Frontiers | The prevalence of dental caries and its associated factors among preschool children in... BackgroundDental caries among preschool children were prevalent worldwide and had a significant impact on children and their families. Understanding its prev... dental cariespreschool childrenfrontiersprevalenceassociated https://www.lifescienceglobal.com/independent-journals/journal-of-basic-and-applied-sciences/volume-13/84-abstract/jbas/2797-abstract-clinical-prevalence-of-peste-des-petits-ruminants-ppr-disease-in-small-ruminants-at-the-urban-areas-of-hyderabad-sindh Abstract : Clinical Prevalence of Peste Des Petits Ruminants (PPR) Disease in Small Ruminants at... Clinical Prevalence of Peste Des Petits Ruminants (PPR) Disease in Small Ruminants at the Urban Areas of Hyderabad, Sindh petits ruminantsabstractclinicalprevalencepeste https://www.statimetric.com/chlamydia/county/40043 Dewey County, OK | Chlamydia Prevalence | Statimetric dewey countyokchlamydiaprevalence https://ijpsr.com/bft-article/a-statistical-study-of-the-prevalence-of-celiac-disease-in-adults-in-two-syrian-governorates-homs-tartous-during-the-period-of-2014-2022/ A STATISTICAL STUDY OF THE PREVALENCE OF CELIAC DISEASE IN ADULTS IN TWO SYRIAN GOVERNORATES (HOMS-... Jun 29, 2024 - Celiac disease is a multisystem immune based disorder that is triggered by the ingestion of gluten in genetically susceptible individuals. Our study was... celiac diseasestatisticalstudyprevalenceadults https://ojvr.org/index.php/ojvr/article/view/1626 Prevalence of canine Babesia and Ehrlichia co-infection and the predictive value of haematology |... The Onderstepoort Journal of Veterinary Research (OJVR), is the official publication of the Onderstepoort Veterinary Institute. It publishes scientific papers... prevalencecaninebabesiaehrlichiaco https://www.acepnow.com/article/choosing-right-medication-critical-combat-extended-spectrum-beta-lactamase-infections/acep_1116_pg13b/ Prevalence of fluoroquinolone-resistant and ESBL-producing Escherichia coli infections among... Nov 12, 2016 - ACEP Now offers real-time clinical news, news from the American College of Emergency Physicians, and news on practice trends and health care reform for the... escherichia coliprevalenceresistantesblproducing https://www.researchwithrowan.com/en/publications/effects-of-traditional-and-western-environments-on-prevalence-of-/ Effects of traditional and western environments on prevalence of type 2 diabetes in Pima Indians in... effectstraditionalwesternenvironmentsprevalence https://oncohemakey.com/prevalence-and-management-of-castration-resistant-prostate-cancer-of-unknown-metastatic-status-in-the-real-world-setting-the-afrodita-study/ Prevalence and management of castration-resistant prostate cancer of unknown metastatic status in... prostate cancerprevalencemanagementcastrationresistant https://unipv.unifind.cineca.it/resource/item/185836?language=en-US UNIFIND - UNIPV -Phenotypic spectrum and prevalence of INPP5E mutations in Joubert Syndrome and... Unifind is a portal where you can discover the expertise within a university by searching among experts, courses, professions, people, publications, and... joubert syndromephenotypicspectrumprevalencemutations https://scholarlycommons.law.northwestern.edu/jclc/vol84/iss2/3/ "Criminal Defendants with Psychiatric Impairment: Prevalence, Probabili" by Ellen Hochstedler Steury By Ellen Hochstedler Steury, Published on 01/01/93 criminaldefendantspsychiatricimpairmentprevalence https://www.worldwidejournals.com/international-journal-of-scientific-research-(IJSR)/fileview/January_2018_1514808037__28.pdf Prevalence of impacted maxillary Canine teeth & Dentigerous cyst (A prospective study) - Current... IJSR - International Journal of Scientific Research for current issue. We have Published 9855+ Research Paper and 100+ Articles from over 100 Countries. 36572+... canine teethdentigerous cystprospective studyprevalenceimpacted https://bookmarksknot.com/story23348944/ice-in-oz-prevalence-data-and-criminal-framework Ice in Oz: Prevalence Data and Criminal Framework prevalence dataiceozcriminalframework https://scholars.mssm.edu/en/publications/prevalence-of-preoperative-palliative-care-needs-and-association-/ Prevalence of Preoperative Palliative Care Needs and Association with Healthcare Use and Cost among... palliative careassociation withprevalenceneedshealthcare https://www.mattioli1885journals.com/index.php/actabiomedica/article/view/2709 Prevalence of hepatitis E and hepatitis B dual infection in North India (Delhi) | Acta Biomedica... hepatitis enorth indiaacta biomedicaprevalencedual https://www.epistemonikos.org/en/documents/d9f43c2c7fd23959b2719ff7eddf619cd8747c5e EFFECT OF A HOMESTEAD FOOD PRODUCTION PROGRAM ON THE PREVALENCE OF DIARRHEA AND ACUTE RESPIRATORY... food productioneffecthomesteadprogramprevalence https://www.siemens-healthineers.com/en-sg/computed-tomography/naeotom/pcct-scientific-evidence/dane-2024 Pancreatic cyst prevalence and detection with photon counting CT compared with conventional energy... Pancreatic cyst prevalence and detection with photon counting CT compared with conventional energy integrating detector CT photon counting ctconventional energypancreaticcystprevalence https://www.ijhpm.com/article_4003.html Understanding the Prevalence and Associated Factors of Behavioral Intention of COVID-19 Vaccination... BackgroundThe prevalence of coronavirus disease 2019 (COVID-19) vaccination is very critical in controlling COVID-19. This study mainly aimed to (1)... understanding theprevalenceassociatedfactorsbehavioral https://greenmedinfo.com/article/aluminum-vaccine-adjuvants-appear-contribute-rising-prevalence-autism Do aluminum vaccine adjuvants contribute to the rising prevalence of Aluminum vaccine adjuvants appear to contribute to the rising prevalence of autism. vaccine adjuvantsto thealuminumcontributerising https://opencardiovascularmedicinejournal.com/VOLUME/6/PAGE/68/ABSTRACT/ Prevalence and Control of Hypertension in Iraqi Diabetic Patients: A Prospective Cohort Study Prevalence and Control of Hypertension in Iraqi Diabetic Patients: A Prospective Cohort Study and controlcohort studyprevalencehypertensioniraqi https://www.saudifetp.org/fetp-studies/prevalence-and-determinants-depression-anxiety-and-stress-among-secondary-school Prevalence and determinants of depression, anxiety and stress among secondary School students in... Introduction To assess depression, anxiety and stress among of secondary school students in Riyadh City. Methodology it was a cross sectional, self... secondary school studentsprevalencedeterminantsdepressionanxiety https://faculty.ksu.edu.sa/ar/osamarkandi/publication/431941 Prevalence of Insomnia and its Characteristics among Pilgrims in the 2024 Hajj: A Roadmap to... Abstract Religious pilgrimages, such as the Hajj, are widely publicized gatherings that attract millions of people worldwide. These events can strain the... prevalenceinsomniacharacteristicsamongpilgrims https://njcmindia.com/index.php/file/article/view/1078?articlesBySimilarityPage=6 Prevalence of Depression amongst Higher Secondary School Adolescents in Bhopal Madhya Pradesh |... higher secondarymadhya pradeshprevalencedepressionschool https://archivestsc.com/jvi.aspx?un=TKDA-49514&volume=19&issue=1 Survey on Prevalence of Cardiac Disease and its Risk Factors in Adults in Turkey: 2. Results... cardiac diseaserisk factorssurveyprevalenceadults https://aidsreviews.com/en/2016/prevalence-and-disease-burden-of-hcv-coinfection-in-hiv-cohorts-in-the-asia-pacific-region-a-systematic-review-and-meta-analysis/ Prevalence and Disease Burden of HCV Coinfection in HIV Cohorts in the Asia Pacific Region: A... asia pacific regiondisease burdenprevalencehcvhiv https://www.alliedacademies.org/abstract/the-prevalence-of--thalassemia-in-south-western-maharashtra-981.html The prevalence of ? Thalassemia in South Western Maharashtra | Abstract The early identification of some clinically significant hemoglobinopathies and precise differentiation of hemoglobin variants are important to provide.. prevalencethalassemiasouthwesternmaharashtra https://www.journal-imab-bg.org/statii/vol10book1p11.htm PREVALENCE OF CHLAMYDIA TRACHOMATIS INFECTION IN SYMPTOMATIC PATIENTS IN BULGARIA JofIMAB 2004; 10(1):11-14, Journal of IMAB, Annual Proceeding Scientific Papers chlamydia trachomatisprevalenceinfectionpatientsbulgaria https://repositorio.bc.ufg.br/items/73cddfe4-4678-4690-b105-45cad535a52a Prevalence, control and treatment of arterial hypertension in Nobres - MT Background: Systemic Arterial Hypertension (SAH), considered a public health problem due to its high prevalence and difficult control, is also described as one... prevalencecontroltreatmentarterialhypertension https://pure.ug.edu.gh/en/publications/prevalence-of-weight-loss-maintenance-success-in-previous-partici/fingerprints/ Prevalence of weight loss maintenance success in previous participants of a commercial weight loss... weight lossprevious participantsprevalencemaintenancesuccess https://www.acibademhealthpoint.com/the-cytomegalovirus-prevalence-in-the-us/ The Cytomegalovirus Prevalence In The US | Acibadem Health Point - ACIBADEM Hospitals - Acibadem... Dec 27, 2025 - Cytomegalovirus Prevalence in the US Cytomegalovirus (CMV) is a common virus belonging to the herpesvirus family, and its prevalence in the U cytomegalovirusprevalencehealthpointhospitals https://www.ijsr.net/rate_article.php?paperid=NOV163182 Rate Article: The Prevalence of Urinary Tract Infection among Pregnant Women Attending Antenatal... Rate the article titled 'The Prevalence of Urinary Tract Infection among Pregnant Women Attending Antenatal Clinic at Atertiary Care Centrein AlRass, Al... urinary tract infectionpregnant womenratearticleprevalence https://baptisthealth.elsevierpure.com/en/publications/prevalence-and-outcomes-of-atrial-fibrillation-in-patients-hospit/ Prevalence and outcomes of atrial fibrillation in patients hospitalized with COVID-19 - Baptist... atrial fibrillationin patientsprevalenceoutcomeshospitalized https://www.iiste.org/Journals/index.php/JEP/article/view/31983/32853 Prevalence and Determinants of Epilepsy among School Children in Aseer Region- KSA | Rabie |... Prevalence and Determinants of Epilepsy among School Children in Aseer Region- KSA school childrenprevalencedeterminantsepilepsyamong https://www.semanticscholar.org/topic/dissemination-of-AODU-prevalence-information/10797354 dissemination of AODU prevalence information | Semantic Scholar semantic scholardisseminationprevalenceinformation https://ricerca.unich.it/handle/11564/156475 Tobacco use prevalence, knowledge and attitudes among Italian hospital healthcare professionals. tobacco usehealthcare professionalsprevalenceknowledgeattitudes https://physioquart.awf.wroc.pl/Urinary-incontinence-prevalence-in-the-day-by-day-life-and-during-sports-practice,76926,0,2.html Urinary incontinence prevalence in the day-by-day life and during sports practice in volleyball... Introduction: Urinary incontinence (UI) is perceived as a problem that affects older and multiparous women. However, recent studies report that involuntary... urinary incontinencethe dayprevalencelifesports https://hub.tmu.edu.tw/en/publications/prevalence-of-antimicrobial-resistance-in-helicobacter-pylori-iso/fingerprints/ Prevalence of antimicrobial resistance in Helicobacter pylori isolates in Taiwan in relation to... antimicrobial resistancehelicobacter pyloriprevalenceisolatestaiwan https://ciencia.ucp.pt/pt/activities/the-role-and-the-prevalence-of-icaabdc-aap-and-bhp-genes-in-the-v/ The role and the prevalence of icaABDC, aap and bhp genes in the virulence of Staphylococcus... roleprevalenceaapbhpgenes https://avesis.erciyes.edu.tr/yayin/30848dfa-cf47-4bcf-a6e8-f945acb85e82/escherichia-coli-o157-in-fish-prevalence-antimicrobial-resistance-biofilm-formation-capacity-and-molecular-characterization Escherichia coli O157 in fish: Prevalence, antimicrobial resistance, biofilm formation capacity,... escherichia coliantimicrobial resistancefishprevalencebiofilm https://researchconnect.stonybrook.edu/en/publications/the-effect-of-treatment-of-idiopathic-intracranial-hypertension-o/ The Effect of Treatment of Idiopathic Intracranial Hypertension on Prevalence of Retinal and... the effecttreatmenthypertensionprevalenceretinal https://scienmag.com/tag/prevalence-of-burnout-in-dentistry/ prevalence of burnout in dentistry | Science prevalenceburnoutdentistryscience https://research.regionh.dk/en/publications/prevalence-of-psoriatic-arthritis-in-patients-with-psoriasis-a-sy/ Prevalence of psoriatic arthritis in patients with psoriasis: A systematic review and meta-analysis... a systematic reviewpsoriatic arthritisin patientsmeta analysisprevalence https://scholars.uky.edu/es/publications/prevalence-and-correlates-of-diagnosed-and-undiagnosed-hypertensi/ Prevalence and correlates of diagnosed and undiagnosed hypertension in the indigenous Kuna... prevalencecorrelatesdiagnosedhypertensionindigenous https://mural.maynoothuniversity.ie/id/eprint/9994/ Seasonal prevalence of the insect pathogenic fungus Colletotrichum nymphaeae in Brazilian citrus... seasonalprevalenceinsectpathogenicfungus https://aahd.us/2008/03/depressive-symptoms-and-clinical-depression-and-people-with-disabilities-prevalence/ Depressive Symptoms and Clinical Depression and People with Disabilities: Prevalence - AAHD Mar 18, 2008 - BRIEFING SUMMARY This briefing summary provides an overview of some of the issues involved with depressive symptoms and clinical depression in people with... people with disabilitiesclinical depressiondepressivesymptomsprevalence https://www.jucm.com/tag/c-difficile-infection-prevalence/ C. difficile infection prevalence Archives - Journal of Urgent Care Medicine urgent caredifficileinfectionprevalencearchives https://ranzcogasm.com.au/poster/identifying-prevalence-of-post-traumatic-stress-disorder-symptoms-in-pregnant-women-after-a-previous-emergency-caesarean-section/ Identifying Prevalence of Post-traumatic Stress Disorder Symptoms in Pregnant Women After a... post traumatic stresspregnant womenidentifyingprevalencedisorder https://e-cep.org/journal/view.php?number=20125555866 Shim: Rickets prevalence and treatment outcome: real-world data from Taiwan real world datatreatment outcomeshimricketsprevalence https://pure.ul.ie/en/publications/prevalence-of-self-reported-chronic-pain-among-adolescents-eviden/ Prevalence of self-reported chronic pain among adolescents: Evidence from 42 countries and regions... countries and regionschronic painprevalenceselfreported