Robuta

https://www.gogoalstream.com/ THIS DOMAIN HAS BEEN SEIZED this domainhas beenseized https://www.sysselmesteren.no/en/news/2026/09/russian-ship-seized-in-svalbard/ Russian ship seized in Svalbard | Governor of Svalbard russianshipseizedsvalbardgovernor https://8v.com/info/crypto-news/breaking/why-are-bitcoin-etfs-such-a-big-deal-gold-provides-a-100-billion-answer/ This Website Has Been Seized this websitehas beenseized https://www.knkx.org/2026-04-19/u-s-says-it-seized-an-iranian-cargo-ship-ceasefire-expires-soon U.S. says it seized an Iranian cargo ship, ceasefire expires soon | KNKX Public Radio Apr 19, 2026 - The two-week ceasefire between the US and Iran is set to expire Wednesday. And the two sides seem far from a resolution. President Trump says the US has taken... u scargo shippublic radiosaysseized https://www.fox10phoenix.com/news/drugs-guns-and-thousands-of-dollars-seized-from-glendale-home-police-say Drugs, guns and thousands of dollars seized from Glendale home, police say | FOX 10 Phoenix A massive amount of illegal drugs were seized at a Glendale home on June 20, the police department said. thousands of dollarsglendale homedrugsgunsseized https://www.ica.gov.sg/news-and-publications/newsroom/media-release/14452_20180724170527 ICA | About 1.8kg of Heroin Seized at Tuas Checkpoint ICA is responsible for the security of Singapore's borders against the entry of undesirable persons, cargo and conveyances through our land, air and sea... icaheroinseizedtuascheckpoint https://retiredanalyst.blogspot.com/2022/12/firearm-anti-personnel-mines-seized-in.html Key Philippine Military and Insurgency-Related Events: Firearm, anti-personnel mines seized in... From the Philippine News Agency (Dec 15, 2022): Firearm, anti-personnel mines seized in Leyte clash (By Sarwell Meniano) SEIZED. A shotgun,... related eventskeyphilippinemilitaryinsurgency https://www.tampafp.com/mount-dora-man-arrested-nearly-14-ounces-of-cocaine-seized-during-florida-keys-traffic-stop/ Mount Dora Man Arrested, Nearly 14 Ounces Of Cocaine Seized During Florida Keys Traffic Stop -... Apr 20, 2026 - A Mount Dora man is behind bars after a late-night traffic stop in the Florida Keys uncovered a massive haul of narcotics early Monday morning. Tampa Free Press mount doraflorida keystraffic stopmanarrested https://www.defconalerts.com/p/boarding-incident-near-fujairah-uae Boarding Incident Near Fujairah, UAE - Vessel Seized By Regional Authorities Incident: The Portuguese-flagged MSC Aries was reported to have been "seized by regional authorities" according to the United Kingdom Maritime Trade Operations... regional authoritiesboardingincidentnearfujairah https://www.ndtvprofit.com/india/punjab-news-police-bust-bki-terror-module-grenades-amp-ied-material-seized-11334755 Punjab News: Police Bust BKI Terror Module, Grenades And IED Material Seized The group was allegedly preparing to carry out major attacks aimed at disturbing peace in the state, police said. punjab newspolicebustbkiterror https://investincryptonews.com/467k-in-crypto-seized-as-spain-cracks-down-on-illegal-piracy-platform/ $467K In Crypto Seized As Spain Cracks Down On Illegal Piracy Platform - Invest In Crypto News Apr 24, 2026 - Trusted Editorial content, reviewed by leading industry experts and seasoned editors. Ad Disclosure Spanish police made an unusual discovery during their raid... in cryptoseizedspaincracksillegal https://americasvoice.news/200-kilograms-of-fentanyl-seized/ 200 KILOGRAMS OF FENTANYL SEIZED - Real America's Voice News Real America's Voice News is your one stop news and entertainment network. real americavoice newsfentanylseized https://futurefive.co.nz/story/kim-dotcom-recovers-6m-seized-funds Kim Dotcom recovers $6m seized funds Megaupload founder secures the use of seized funds to pay current and future legal bills after Auckland High Court clears the way. kimseizedfunds https://eng.obozrevatel.com/section-world/newsamp-yemeni-houthis-release-the-crew-of-a-ship-seized-in-2023-among-them-are-citizens-of-ukraine-23-01-2025.html Yemeni Houthis release the crew of a ship seized in 2023: among them are citizens of Ukraine We are talking about the cargo ship Galaxy Leader | OBOZ.UA the crewyemenihouthisreleaseship https://www.cb750.com/threads/hot-seized-then-free-rebuild.9912/ Hot seized, then free. Rebuild? | Honda CB750 Forum I did a quick and dirty head gasket and seal up on my 74 750. A few hours of riding in and it seized up on my way home. Completely locked. Let it rest a few... hotseizedfreerebuildhonda https://www.odnako.org/reggio-calabria-illegal-swimming-pool-seized-four-owners-reported/ Reggio Calabria, illegal swimming pool seized: four owners reported Nov 29, 2025 - The Local Police of Reggio Calabria carried out a series of targeted checks in recent days which led to the seizure of a swimming pool ... Read more reggio calabriaswimming poolillegalseizedfour https://blog-freeparts.com/2026/04/14/thuc-hien-chi-dao-cua-lanh-dao-bo-cong-an-va-cuc-canh-sat-moi-truong-ve-dau-tran/ 11 Illegal Waste Dumping Sites, 20,160 Tons Seized: The Hanoi-Link Pollution Ring Targeting Ho Chi... illegalwastedumpingsitesseized https://www.upr.org/2026-04-24/vessels-seized-by-the-u-s-this-week-were-part-of-a-global-shadow-fleet Vessels seized by the U.S. this week were part of a global 'shadow fleet' | Utah Public Radio Apr 24, 2026 - NPR's Juana Summers speaks with Elisabeth Braw, senior fellow at the Atlantic Council, about shadow vessels, after the U.S. military's seizure of two... the uthis weekpart ofshadow fleetpublic radio https://portcalls.com/4-held-p256m-cigarettes-gadgets-seized-in-cavite/ 4 held, P256M cigarettes, gadgets seized in Cavite - PortCalls Asia Jul 11, 2022 - seized tobacco products, smuggling, smuggled goods heldcigarettesgadgetsseizedcavite https://www.telanganatribune.com/100-quintals-of-broken-rice-seized/ 100 Quintals of Broken Rice Seized | Telangana Tribune Oct 11, 2024 - Atmakur (Suryapet): On Thursday, police raided Sri Lakshmi Modern Rice Mill near Patharlapahad Cross Road after receiving information from locals. During the broken riceseizedtelanganatribune https://learn.bybit.com/en/daily-bits/u-s-department-of-justice-transfers-2-billion-in-seized-bitcoin-to-unidentified-wallets U.S. Department of Justice Transfers $2 Billion in Seized Bitcoin to Unidentified Wallets | Bybit... Jul 30, 2024 - A U.S. Department of Justice-affiliated crypto wallet transferred $2 billion worth of confiscated bitcoin, originally seized from Silk Road, to an unidentified... department of justicetransfersbillionseizedbitcoin https://www.charlottealertsnews.com/drugs/1-200-marijuana-plants-seized-from-out-door-grow-operation/ 1,200 MARIJUANA PLANTS SEIZED FROM OUT DOOR GROW OPERATION | CHARLOTTE ALERTS NEWS out doormarijuanaplantsseizedgrow https://thepattayanews.com/2025/11/02/over-3-million-meth-pills-seized-in-massive-chonburi-drug-raid/ Over 3 Million Meth Pills Seized in Massive Chonburi Drug Raid! - The Pattaya News Nov 2, 2025 - Chonburi- Police from the Narcotics Suppression Bureau (NSB) in coordination with Thai Police in Chonburi Province raided a major drug gang from northern... the pattaya newsdrug raidmillionmethpills https://www.thestandard.com.hk/news/article/329833/2-kilograms-of-cannabis-seized-in-Sau-Mau-Ping-traffic-stop-driver-arrested 2 kilograms of cannabis seized in Sau Mau Ping traffic stop, driver arrested A 28-year-old man was arrested on Monday night after police found about two kilograms of suspected cannabis in his car during a traffic stop in Sau Mau Ping,... sau mau pingtraffic stopcannabisseizeddriver https://www.farminguk.com/news/russia-irish-pork-seized-_10191.html Russia-Irish pork seized. - FarmingUK News Jan 16, 2009 - RUSSIA. IRISH PORK SEIZED. There was a consignment of 8 tons of illegal meat sized on Saratov on Tuesday. The meat was of Irish origin and there has been a russiairishporkseizednews https://lists.nanog.org/archives/list/test@lists.nanog.org/message/JYMZN52VSAR3PAYVWB72MTM3DNIKQHW7/ Re: Megaupload.com seized - Test - lists.nanog.org seizedtestlistsnanog https://southfront.press/russian-chinese-iranian-warships-trained-on-freeing-seized-vessel-video/ Russian, Chinese, Iranian Warships Trained On Freeing Seized Vessel (Video) Mar 12, 2025 - Russian, Iranian, and Chinese warships trained to inspect and liberate vessels from mock terrorists in the course of the joint... russianchineseiranianwarshipstrained https://ranked.news/dozens-of-cocaine-packages-seized-in-pacific-11-rescued-from-shipwreck Dozens of cocaine packages seized in Pacific, 11 rescued from shipwreck A news aggregation platform with topic-based filtering and audio playback dozenscocainepackagesseizedpacific https://cknxnewstoday.ca/sarnia/news/2025/06/09/meth-seized-during-traffic-stop Meth seized during traffic stop Three people are facing drug-related charges after Lambton OPP stopped a vehicle in Petrolia and seized an unspecified amount of methamphetamine. traffic stopmethseized https://mymotherlode.com/news/local/125934/plants-seized-in-stanislaus.html Plants Seized In Stanislaus - myMotherLode.com Jan 31, 2009 - Drug agents have seized more than 1,500 marijuana plants growing in Stanislaus County. The Stanislaus Drug Enforcement Agency raided pot gardens in Grayson,... plantsseizedstanislaus https://www.carscoops.com/2019/10/u-s-marshals-auctioning-149-vehicles-seized-from-defunct-dc-solar-company/ U.S. Marshals Auctioning 149 Vehicles Seized From Defunct DC Solar Company | Carscoops Oct 18, 2019 - Included in the auction are three Plymouth Superbirds and dozens of Camaros, Challengers and Mustangs, plus a Bentley, a Maserati and a Jag u smarshalsvehiclesseizeddefunct https://www.midwestradio.ie/news/weapons-seized-by-revenue-in-the-midlands/ Weapons seized by Revenue in the Midlands - Midwest Radio May 7, 2025 - Counterfeit goods which infringe on copyright laws were seized. by revenuethe midlandsweaponsseizedmidwest https://erowid.org/references/refs_view.php?ID=452&S=Speers_JS&SField=Author Erowid.org: Erowid Reference 452 : Composition Profiling of Seized Ecstasy Tablets by Raman... The Index page for the reference article: Bell SEJ, Burns DT, Dennis AC, Matchett LJ, Speers JS Composition Profiling of Seized Ecstasy Tablets by Raman... referencecompositionprofilingseizedecstasy https://cyber-stratus-ai-solution.com/ Diese Plattform wurden beschlagnahmt / This platform have been seized this platformdieseplattformwurdenseized https://wolbbaltimore.com/3707595/slutty-vegan-owner-pinky-coles-georgia-home-seized-amid-bankruptcy-filing/?itm_source=wolbbaltimore.com&itm_medium=in_post&itm_campaign=related_content_widget&itm_content=well Slutty Vegan Owner Pinky Cole's Georgia Home Seized Mar 27, 2026 - Slutty Vegan owner Pinky Cole is fighting back after she says her Georgia home was wrongfully taken by creditors following her bankruptcy filing. sluttyveganownerpinkycole https://www.unekjc.com/2025/02/19/300-million-of-illicit-fentanyl-seized-in-california-since-2023/ $300 million of illicit fentanyl seized in California since 2023 - UNE News Express Feb 19, 2025 - $300 million of illicit fentanyl seized in California since 2023 State continues raising awareness of dangerous drug What you need to know: California is using... in californianews expressmillionillicitfentanyl https://www.arabtimesonline.com/news/kuwaiti-woman-held-at-airport-with-currency-banned-devices-seized/ Kuwaiti woman held at airport with currency - Banned devices seized | arabtimes KUWAIT CITY, Nov 27: The Cairo International Airport police have taken into custody an unidentified Kuwaiti woman ... at airportkuwaitiwomanheldcurrency https://classic.communick.news/comment/8737972?source Judge doesn't trust DOJ with search of devices seized from Wash. Post reporter : politics judgetrustdojsearchdevices https://www.shemazing.net/these-puppies-were-seized-in-hand-luggage-at-dublin-port/ These puppies were seized in hand luggage at Dublin Port today | SHEmazing! hand luggagedublin portpuppiesseizedtoday https://asiaplus.news/en/2011/11/09/over-9-kilos-of-narcotics-seized-in-dushanbe-on-tuesday/ Over 9 kilos of narcotics seized in Dushanbe on Tuesday - Asia Plus Nov 9, 2011 - DUSHANBE, November 9, Asia-Plus -- More than nine kilograms of cannabis have been seized in one operation in Dushanbe. The Interior Ministry kilosnarcoticsseizeddushanbetuesday https://scoopynewz.com/tag/whisky-seized/ whisky seized Archives - Scoopy Newz whiskyseizedarchivesscoopynewz https://westsidepeoplemag.com/manila-says-chinese-boats-seized-equipment-for-philippine-forces/ Manila says Chinese boats seized equipment for Philippine forces Jun 4, 2024 - The Philippine military on Tuesday accused China of "aggressive and unprovoked interference" and said Chinese boats had illegally "seized" food and manilasayschineseboatsseized https://newswatch.in/news/2008/05/21/cambodia-newspapers-supplement-on-burma-seized-by-police-paper-threatened-with-suspension Cambodia: Newspaper's supplement on Burma seized by police, paper threatened with suspension |... A newspaper in Cambodia has had to stop publishing a pullout on Burma after authorities confiscated that section for two consecutive days, warning that a... cambodianewspapersupplementburmaseized https://www.ptcnews.tv/world-news/seized-iranian-ships-chemical-laden-nikki-haley-claims-china-helping-iran-in-west-asia-war-4423776 Seized Iranian Ships chemical-laden? Nikki Haley claims China helping Iran in West Asia war | World... Apr 21, 2026 - She also claimed that China is extending assistance to Iran in war is a reality that can no longer be ignored. west asia warnikki haleyseizediranianships https://vancouver.citynews.ca/2016/11/17/advocates-experts-say-pot-not-laced-fentanyl-despite-reports/ Advocates, experts say pot seized not laced with fentanyl despite reports Nov 18, 2016 - Premier Clark is claiming Vancouver Police have seized marijuana laced with fentanyl but Vancouver Police says it has no record of that happening. laced with fentanylexperts sayadvocatespotseized https://www.outlookindia.com/national/iran-to-soon-allow-indian-authorities-to-meet-17-crew-members-onboard-seized-msc-aries-ship India Officials Get Nod To Meet Indians On Seized Ship In Iran After Jaishankar Dials Iranian... Earlier, on Sunday External Affairs Minister S Jaishankar said he spoke to his counterparts from Iran and Israel and shared his concerns over the ongoing... indiaofficialsgetnodmeet https://en.odfoundation.eu/a/4638,pap-cites-dziennik-polski-vests-seized-will-not-protect-ukrainians/ PAP cites Dziennik Polski: Vests seized will not protect Ukrainians - Open Dialogue Foundation Jan 17, 2020 - Polish Press Agency reports, citing the Dziennik Polski, on the confiscation of bulletproof vests which were part of the humanitarian aid being sent to Ukraine... dziennik polskiopen dialoguepapcitesvests https://www.brecon-radnor.co.uk/news/electric-bike-seized-by-police-in-powys-town-859147 Electric bike seized by police in Powys town | brecon-radnor.co.uk Dec 8, 2025 - An electric bike was seized by police yesterday morning (Sunday, 7 November), and the driver of the vehicle was reported for having no insurance. electric bikeseizedpolicepowystown https://seizedpropertyauctions.com/auctions/270/lot/4066142-premium-pcgs-ms63-semi-pl-1900-20-liberty-gold-piece Premium PCGS MS63+ semi-PL 1900 $20 Liberty Gold Piece - Seized Property Auctions property auctionspremiumpcgssemipl https://www.krgv.com/videos/2-arrested-12-pounds-of-cocaine-seized-in-san-benito-drug-raid-cameron-county-sheriff-s-office-says 2 arrested, 12 pounds of cocaine seized in San Benito drug raid, Cameron County Sheriff's Office... san benitodrug raidcameron countyarrestedpounds https://www.miragenews.com/broadmeadows-cash-200k-stolen-poles-seized-1479229/ Broadmeadows: Cash, $200K Stolen Poles Seized | Mirage News Hume Crime Investigation Unit detectives have arrested a man after a trailer loaded with more than $200K in aluminium was stolen from a Campbellfield broadmeadowscashstolenpolesseized https://www.quattromania.it/2014/11/24/seized-vehicle-auction-knowing-more-about-auctions-of-seized-vehicles/ Seized Vehicle Auction - Knowing More About Auctions Of Seized Vehicles - QuattroMania Nov 24, 2014 - The average driver will typically drive 12,000 to 15,000 miles a year. The higher the number of average annual miles would indicate that most of the About,... vehicle auctionmore aboutseizedknowingauctions https://www.trtworld.com/article/18167717?_rt=1 Israel says it seized Philadelphi Corridor along Gaza-Egypt border - TRT World Israel occupation forces claim they found about 20 tunnels in the area, but Egypt accuses Tel Aviv of using tunnel claims as smokescreen for its brutal Rafah... trt worldisraelsaysseizedcorridor https://www.fox5dc.com/news/putin-superyacht-seized-italy Putin's alleged $700M superyacht seized in Italy | FOX 5 DC Zelenskyy pushes for harsher sanctions as the war in Ukraine persists in italyputinallegedsuperyachtseized https://www.kmuw.org/2026-04-22/iran-says-it-seized-ships-in-strait-of-hormuz-as-u-s-blockade-continues-amid-ceasefire Iran says it seized ships in Strait of Hormuz as U.S. blockade continues amid ceasefire | KMUW Apr 22, 2026 - Three vessels came under fire in the Strait of Hormuz, after the U.S. and Iran failed to meet in Pakistan for talks to end the war and as President Trump... strait of hormuziransaysseizedships https://www.wyomingpublicmedia.org/2026-04-19/u-s-says-it-seized-an-iranian-cargo-ship-ceasefire-expires-soon U.S. says it seized an Iranian cargo ship, ceasefire expires soon | Wyoming Public Media Apr 19, 2026 - The two-week ceasefire between the US and Iran is set to expire Wednesday. And the two sides seem far from a resolution. President Trump says the US has taken... wyoming public mediacargo shipsaysseizediranian https://www.thejakartapost.com/indonesia/2026/04/11/prabowo-directs-seized-money-toward-school-repairs.html Prabowo directs seized money toward school repairs - Politics - The Jakarta Post Prabowo directs seized money toward school repairs - Politics - The Jakarta Post prabowodirectsseizedmoneytoward https://www.lagondaclub.com/forums/reply/brake-cylinder-pistons-seized-how-to-free-53-9/ Reply To: Brake cylinder pistons seized; how to free? - Lagonda Club A thought for the future .There are a few outfits over here that will sleeve the cylinders with stainless and I think use brass pistons. reply tobrakecylinderpistonsseized https://kalingatv.com/odisha/brown-sugar-seized-in-bhubaneswar-3-arrested/ Brown Sugar Seized in Bhubaneswar, 3 Arrested May 31, 2018 - KalingaTV News Network Bhubaneswar : The Quick Action Team (QAT) of Commissionerate Police arrested three drug peddlers in Infocity area in the city this brown sugarseizedbhubaneswararrested https://www.meritstreetmedia.com/news/600-pounds-of-meth-seized-in-celery-shipment-at-us-mexico-border 600 pounds of meth seized in celery shipment at US-Mexico border U.S. Customs and Border Protection officers at the Otay Mesa Commercial Facility seized about 630 pounds of methamphetamine with an estimated street value of... poundsmethseizedceleryshipment https://politico.ph/p1-2-m-smuggled-cigarettes-seized-in-pagadian-city/ P1.2-M Smuggled Cigarettes Seized In Pagadian City | Politico.ph Feb 23, 2026 - Government operatives have seized a shipment of some PHP1.2 million worth of smuggled cigarettes in the province of Zamboanga del Sur, a top police official... cigarettesseizedpagadiancitypolitico https://www.kpax.com/us-news/new-york-city-police-commissioner-resigns-after-his-phone-was-seized-in-federal-investigation NYC police commissioner resigns after phone was seized in federal investigation Sep 12, 2024 - New York City police commissioner Edward Caban resigned after his phone was seized in a federal investigation. He was one of several high-ranking city... nycpolicecommissionerphoneseized https://www.episodate.com/tv-show/contraband-seized-at-the-border Contraband: Seized at the Border Next Episode Air Date Your TV show guide to Countdown Contraband: Seized at the Border Air Dates. Stay in touch with Contraband: Seized at the Border next episode Air Date an... at the bordernext episodeair datecontrabandseized https://sudhirrao.com/my-drone-was-seized-by-indian-customs-legal-steps-to-get-it-back/ My Drone Was Seized by Indian Customs: Legal Steps to Get It Back Jul 25, 2025 - Mr. Sameer Verma, a resident of Janakpuri, recently faced a perplexing situation at the international airport in the coastal city of Navsari. Upon his return get it backindian customslegal stepsdroneseized https://nairametrics.com/2023/12/18/ndlea-seized-drugs-worth-n800-billion-in-3years-brig-gen-buba-rtd/ "NDLEA seized drugs worth N800 billion in 3years"- Brig. Gen. Buba (rtd) - Nairametrics Dec 18, 2023 - The Chairman of the National Drug Law Enforcement Agency (NDLEA), Brig. Gen. Buba (rtd), informed that over three years nationwide, seized drugsndleaworthbillionbrig