Robuta

https://baltimorechronicle.com/society/the-russian-army-shelled-16-settlements-in-the-sumy-region-per-day/ The Russian army shelled 16 settlements in the Sumy region per day Apr 7, 2024 - As a result of the strikes, power lines, a civil infrastructure facility, a garage and vehicles were damaged. 16 settlements in the Sumy region. This was russian armyshelled https://en.socportal.info/en/news/utrom-rossiyane-obstrelyali-kherson-est-ranenye/ In the morning of 3 August, Russians shelled Kherson, three people were wounded The Russian army launched an artillery strike on public transport that was taking people to work. in the morning https://borova.gromada.group/en/news/all/7-8-sichnya-vorog-obstrilyuvav-harkivshinu-bezpilotnikami-na-livoberezhzhi-borivshini-trivaye-evakuaciya On January 7-8, the enemy shelled the Kharkiv region with drones, evacuation of the Borova... https://eng.obozrevatel.com/section-life/newsamp-occupants-shelled-nikolske-in-kherson-region-and-attacked-orikhiv-in-zaporizhzhia-there-are-dead-photo-13-07-2023.html Occupants shelled Nikolske in Kherson region and attacked Orikhiv in Zaporizhzhia: there are dead.... Pictures of the gruesome aftermath of the attack have emerged | OBOZ.UA https://akurtakov.blogspot.com/2011/11/shelled-201-is-out.html Random things will appear: ShellEd 2.0.1 is out I forgot to announce the Linux Tools 0.9 release. Please check the New and Noteworthy for details. There a number of fixes and enhancement... random thingsappearshelled https://www.inpaksystems.com/industries/corn-cracked-shelled-cob-bagging-equipment-inpak/ Corn (Cracked, Shelled & Ear) Bagging Equipment | Inpak Systems, Inc. bagging equipmentcorncrackedshelledear https://cideips.com/russian-occupiers-shelled-residential-buildings-in-kramatorsk-ukraine/ Russian occupiers shelled residential buildings in Kramatorsk, Ukraine - Oct 31, 2025 - Russian occupiers shelled residential buildings in Kramatorsk, Ukraine On October 30, at around 2:50 p.m., the invaders carried out strikes on residential... residential buildingsrussianoccupiersshelledkramatorsk https://wits.worldbank.org/trade/comtrade/en/country/KEN/year/2021/tradeflow/Exports/partner/ALL/product/071340 Kenya Dried lentils, shelled exports by country | 2021 | Data dried lentilsby countrykenyashelledexports https://russia-ukraine-war.online/the-russian-army-shelled-peoples-homes-in-kupyansk-the-yard-was-on-fire/ The Russian army shelled people's homes in Kupyansk: The yard was on fire - russia-ukraine-war Aug 31, 2023 - The Russians continue to shell the Kupyan district of the Kharkiv region. In the city of Kupyansk, Kharkiv Region, as a result of Russian shelling, a fire... https://wits.worldbank.org/trade/comtrade/en/country/SAU/year/2023/tradeflow/Imports/partner/ALL/product/071331 Saudi Arabia Dried beans, shelled imports by country | 2023 | Data saudi arabiadried beansby countryshelledimports https://wits.worldbank.org/trade/comtrade/en/country/ETH/year/2023/tradeflow/Exports/partner/ALL/product/071331 Ethiopia(excludes Eritrea) Dried beans, shelled exports by country | 2023 | Data dried beansby countryethiopiaexcludeseritrea https://www.animaldiversity.org/accounts/Cycloderma_frenatum/classification/ Cycloderma frenatum (Zambezi Soft-shelled Turtle) | CLASSIFICATION | Animal Diversity Web soft shelled turtlezambeziclassificationanimaldiversity https://www.ivaxdiagnostics.com/es/shop/boc-1391-11-silver-shelled-gold-bare-citrate-20-nm-1-mg-ml-in-aqueous-2-mm-sodium-citrate-65490 Silver Shelled Gold - Bare (Citrate) - 20 nm, 1 mg/mL in aqueous 2 mM sodium citrate | IVAX... https://www.mandorlemeli.it/en/product-page/mandorla-cv-tuono-siciliana-sgusciata ALMOND CV TUONO SICILIANA - Shelled | Mandorle Meli The CV TUONO Almond was born in Sicily in the provinces of Syracuse, Ragusa and Agrigento. It contains a significant % of proteins, B vitamins, magnesium, iron... almondcvtuonoshelledmandorle https://www.asianews.it/news-en/Aleppo:-two-Orthodox-bishops-still-captive,-Christian-neighbourhood-shelled-27784.html SYRIA Aleppo: two Orthodox bishops still captive, Christian neighbourhood shelled For Mgr Jeanbart, Greek Melkite bishop of Aleppo, syriaaleppotwoorthodoxbishops https://en.lb.ua/news/2022/03/08/10431_mykolaiv_area_occupiers.html In the Mykolaiv area occupiers shelled the minibus in which orphan teachers went According to preliminary data, three governesses died. in themykolaivareaoccupiers https://www.soapandthings.com/53400-SHINY-GOLD--METAL-SHELLED-caplidtop-_p_2577.html 53/400 SHINY GOLD - METAL SHELLED cap/lid/top -2577 53/400 SHINY GOLD - METAL SHELLED cap/lid/top -PLASTIC CAPS, METAL SHELLED CLOSURE WITH A 53/400 FINISH, INCLUDES A FOAM LINER, BY MPCH shinygoldmetalshelledcap https://wits.worldbank.org/trade/comtrade/en/country/NZL/year/2021/tradeflow/Imports/partner/ALL/product/071320 New Zealand Dried chickpeas, shelled imports by country | 2021 | Data new zealandby countrydriedchickpeasshelled https://syrniaguide.com/Bestiary/Steel%20Shelled%20Turtle Steel Shelled Turtle | SyrniaGuide steelshelledturtle https://wits.worldbank.org/trade/comtrade/en/country/WLD/year/2021/tradeflow/Imports/partner/ALL/product/071029 World Leguminous vegetables, shelled or unshelled, fr imports by country | 2021 | Data https://wits.worldbank.org/trade/comtrade/en/country/PER/year/2024/tradeflow/Exports/partner/ALL/product/071320 Peru Dried chickpeas, shelled exports by country | 2024 | Data by countryperudriedchickpeasshelled https://backwaterangler.com/product/patagonia-ms-shelled-insulator-pants/ Patagonia M's Shelled Insulator Pants - BACKWATER ANGLER These versatile, highly water-resistant, insulated soft-shell pants provide stretch, warmth and windproof protection for fishing in cool or cold conditions.... m spatagoniashelledinsulatorpants https://wits.worldbank.org/trade/comtrade/en/country/PHL/year/2024/tradeflow/Exports/partner/ALL/product/071022 Philippines Shelled or unshelled beans, frozen exports by country | 2024 | Data by countryphilippinesshelledbeans https://ilpistacchio.shop/en/almond/272-263-shelled-sicilian-almond-8055942720556.html Sicilian Almond Shelled Sicilian Almond Shelled sicilianalmondshelled https://wits.worldbank.org/trade/comtrade/en/country/All/year/2021/tradeflow/Imports/partner/SAU/product/071029 Leguminous vegetables, shelled or unshelled, fr imports from Saudi Arabia |2021 saudi arabiavegetablesshelled https://www.unio.lu/freshwater-mussel/biology/anatomy/ Anatomy - Biology - Thick shelled river mussel Life UNIO / Natura 2000 Anatomy. Biology. Thick shelled river mussel Life UNIO / Natura 2000 anatomybiologythickshelledriver https://wits.worldbank.org/trade/comtrade/en/country/CRI/year/2024/tradeflow/Exports/partner/ALL/product/071320 Costa Rica Dried chickpeas, shelled exports by country | 2024 | Data costa ricaby countrydriedchickpeasshelled https://www.treasuresmadefromyarn.com/2011/04/shelled-socks-finished.html Shelled Socks Finished A blog about crocheting and knitting. I list my works in progress. free knitting and crochet patterns and anything craft related. shelledsocksfinished https://www.blizzardshelledtechnology.com/ Blizzard Shelled Technology | In & Out Storage blizzardshelledtechnologystorage https://perfetto-home.com/shop/elegant-black-crocodile-wine-gift-bag-hard-shelled-reusable-champagne-beer-bottle-carrier/ Elegant Black Leather Wine Gift Bag - Hard-Shelled Reusable Champagne & Beer Bottle Carrier -... Dec 1, 2025 - Elevate your gifting experience with our Wine Gift Bag in Black Leather! This luxurious hard-shelled bag is designed for wine, https://research.polyu.edu.hk/en/publications/microplastics-and-food-shortage-impair-the-byssal-attachment-of-t/ Microplastics and food shortage impair the byssal attachment of thick-shelled mussel Mytilus... https://shilohfarms.com/shelled-pumpkin-seeds-organic/ Shelled Pumpkin Seeds | Organic-Raw | Shiloh Farms pumpkin seedsorganic rawshelledshilohfarms https://altoona.craigslist.org/grd/d/seanor-ear-shelled-cracked-corn-straw/7932050889.html Ear, Shelled, Cracked Corn: Straw Bales - farm & garden - by owner - sale - craigslist Ear Corn Bagged--(1 Bushel Bag)--$5.00 a Bag Shelled Corn--(50# Bag) $9.00 a Bag Cracked Corn--(50# Bag)--$11.00 a Bag Straw Bales---$5.00 a bale (Windber)... cracked cornstraw bales https://www.ourdailybreaddeli.com/product/pistachios-raw-shelled-1-3-pound-containers/656 Pistachios - Raw, Shelled, 1/3 pound containers | Our Daily Bread Deli California Grown -Pistachios are little nutritional powerhouses. A rich source of protein and minerals, they are perfect as a cooking ingredient, or just for a... our daily breadpistachiosrawshelled https://distribuidoralatinoandina.com/en/products/dry-en/shelled-peanuts-el-plebeyo/ El Plebeyo Shelled Peanuts | Distribuidora Latinoandina el plebeyoshelledpeanutsdistribuidora https://wits.worldbank.org/trade/comtrade/en/country/MNT/year/2024/tradeflow/Exports/partner/ALL/product/071022 Montenegro Shelled or unshelled beans, frozen exports by country | 2024 | Data by countrymontenegroshelledbeans https://namvietnamese.com/bun-rieu-cua-with-softshelled-crab/ Bun Rieu Cua (with Soft-Shelled Crab) | Nam Richmond Hill Tomato-based soup with vermicelli, pork, shrimp, crab paste, tofu, eggs, Vietnamese ham, and pork jello. Also served with a soft-shelled crab on the side. Can... buncuasoftshelledcrab https://fraservalleyhazelnuts.com/product/shelled-raw-hazelnuts/ Shelled - Raw Hazelnuts | Fraser Valley Hazelnuts Feb 28, 2026 - Size: 250g Locally grown and processed hazelnuts, without shell. Packaged, shelled hazelnuts. Raw, unpasteurized. Fresh and delicious. shelledrawhazelnutsfraservalley https://newsomspeanutshop.com/product-tag/shelled-salted-peanuts/ shelled salted peanuts | Newsoms Peanut Shop salted peanutsshelledshop https://eng.obozrevatel.com/section-war/newsamp-occupants-shelled-a-village-in-zaporizhzhia-with-grad-rockets-3-civilians-were-injured-photo-15-07-2023.html Occupants shelled a village in Zaporizhzhia with Grad rockets: 3 civilians were injured. Photo A shell hit the building of the village council https://wits.worldbank.org/trade/comtrade/en/country/MUS/year/2024/tradeflow/Exports/partner/ALL/product/071320 Mauritius Dried chickpeas, shelled exports by country | 2024 | Data by countrymauritiusdriedchickpeasshelled https://tariff.synnaxstudio.com/hs-code/0713312000-beans-of-the-species-vigna-mungo-l-hepper-or-vigna-radiata-lwilczek-if-entered-for-consumption-during-the-period-from-may-1-to-august-31-inclusive-in-any-year HS Code 0713.31.2000: Dried leguminous vegetables, shelled, whether or n... Import Duty (2026) https://vasgallery.org.au/A-Shelled-Shelf~133795 A Shelled Shelf shelledshelf https://www.calorieking.com/us/en/foods/f/calories-in-canned-legumes-beans-shelled-blackeye-peas-with-jalapenos/agmMPVV8QuqyMxntLP391w Calories in Food Club Shelled Blackeye Peas With Jalapenos | CalorieKing There are 120 calories in 1 1/2 cup (4.4 oz) of Food Club Shelled Blackeye Peas With Jalapenos. You'd need to walk 33 minutes to burn 120 calories. Visit... calories in foodclubshelledblackeyepeas https://en.auroranews.am/news/2022-09-29-refugee-convoy-shelled-near-kharkiv-around-30-casualties-reported Refugee Convoy Shelled Near Kharkiv, Around 30 Casualties Reported refugeeconvoyshellednearkharkiv https://russia-ukraine-war.online/russians-shelled-slovyansk-one-person-was-killed-two-children-were-among-the-wounded/ Russians shelled Slovyansk: one person was killed, two children were among the wounded -... Oct 8, 2024 - Russians attacked Slovyansk in Donetsk region. One person died, and seven more were injured, including two children. https://fdanj.nlm.nih.gov/catalog/ffnj06974 6974. Adulteration of shelled peanuts. U. S. v. 3 Bags of Shelled Peanuts. Consent decree of... u s https://www.indexmundi.com/agriculture/?country=ph&commodity=almonds&graph=beginning-stocks Philippines Almonds, Shelled Basis Beginning Stocks by Year (MT) Chart and table showing historical data - Philippines Almonds, Shelled Basis Beginning Stocks by Year (MT) by yearphilippinesalmondsshelledbasis https://tjstrailers.com/part/trailer-brake-emulator-6562-7-way-blade-clam-shelled/ TRAILER BRAKE EMULATOR #6562 7 way blade - clam shelled - TJ's Trailers TRAILER BRAKE EMULATOR #6562 7 way blade - clam shelled https://www.indexmundi.com/agriculture/?country=ch&commodity=almonds&graph=production-growth-rate Switzerland Almonds, Shelled Basis Production Annual Growth Rate Chart and table showing historical growth rate - Switzerland Almonds, Shelled Basis Production by Year switzerlandalmondsshelledbasisproduction https://wits.worldbank.org/trade/comtrade/en/country/LTU/year/2024/tradeflow/Exports/partner/ALL/product/071320 Lithuania Dried chickpeas, shelled exports by country | 2024 | Data by countrylithuaniadriedchickpeasshelled https://www.animestats.tf/anime/4186/Koukaku_no_Regios Chrome Shelled Regios (Koukaku no Regios) ratings by episode | Anime Stats In a post-apocalyptic world overrun with mutated beasts called Limbeekoon or Filth Monsters, humanity is forced to live in large mobile cities called Regios... chrome shelled regiosno ratingsepisodeanimestats https://cinchycooking.netlify.app/fresh-shelled-black-eyed-peas-recipe.html Fresh Shelled Black Eyed Peas Recipe black eyed peasfreshshelledrecipe https://russia-ukraine-war.online/russians-shelled-more-than-15-settlements-in-kharkiv-region/ Russians shelled more than 15 settlements in Kharkiv region - russia-ukraine-war Jan 9, 2024 - A 56-year-old man was hospitalized with shrapnel wounds and is in moderate condition. The enterprise, electric poles were damaged. more than https://wits.worldbank.org/trade/comtrade/en/country/All/year/2021/tradeflow/Exports/partner/CHN/product/071339 Dried beans, shelled, nes exports to China |2021 dried beansshellednesexportschina https://cideips.com/the-enemy-shelled-the-epicenter-hypermarket-in-kharkiv/ The enemy shelled the Epicenter hypermarket in Kharkiv - Sep 5, 2024 - Today, at about 16:00, Russian occupants launched an air strike on the Kyiv district of Kharkiv. According to preliminary information, the enemy used KAB... the enemyshelledepicenterhypermarketkharkiv https://www.unio.lu/project-data/3116/international-water-meeting--sauer/ International water meeting / Sauer 2018 - Water meeting - Thick shelled river mussel Life UNIO /... International water meeting / Sauer 2018. Water meeting. Thick shelled river mussel Life UNIO / Natura 2000 internationalwatermeetingsauer https://www.nurnberg2022.org/en/post/russian-smerch-shelled-city-center Russian "Smerch" shelled city center Mar 11, 2022 - 09.03.2022Kharkiv. Russian troops fired at the city center from the "Smerch" multiple rocket launcher.As a result of the shelling of the center of Kharkiv by... russianshelledcitycenter https://slimcalories.com/supermarkets/tesco/fresh-food/fresh-vegetables/ready-to-cook-vegetables/tesco-hand-shelled-peas-170g-100g-contains Tesco (Tesco Hand Shelled Peas 170G (100g contains), Fresh Food) calories and nutrition facts https://thediplomat.com/2026/05/a-year-after-the-war-kashmirs-border-civilians-sit-between-shelled-roofs-and-self-made-bunkers/ A Year After the War: Kashmir’s Border Civilians Sit Between Shelled Roofs and Self-Made Bunkers –... May 7, 2026 - “We can rely on bunkers, but not on ceasefires.” https://www.inaexport.id/produk/other-agriculture-products/19608/nutmeg-shelled Nutmeg shelled | Inaexport InaExport as a media product digital promotion superior export products from Indonesian business people, so they can more easily reach out to foreign buyers. nutmegshelled https://www.thenutswarehouse.com/product-page/shelled-brazil-nuts-500gm Shelled Brazil Nuts 500g | thenutswarehouse Brazil nuts come from the South American Bertholletia excelsa, or Brazil nut, tree. Besides selenium, brazil nuts contain plenty of protein, essential minerals... brazil nutsshelled https://kalejunkie.com/?taxonomy=wprm_ingredient&term=shelled-edamame Shelled Edamame Archives - Kalejunkie shellededamamearchives https://fdanj.nlm.nih.gov/catalog/ffnj22926 22926. Shelled black walnuts. - FDA Notices of Judgment Collection, 1908-1966 black walnutsjudgment collectionshelledfda https://www.mynetdiary.com/food/calories-in-steam-in-bag-mukimame-shelled-edamame-by-good-gather-cup-29253859-0.html Calories in Steam-in-bag Mukimame Shelled Edamame by Good & Gather and Nutrition Facts There are 160 calories in cup of Steam-in-bag Mukimame Shelled Edamame from: Carbs 12g, Fat 6.7g, Protein 13g. Get full nutrition facts. https://borova.gromada.group/en/news/all/minuloyi-dobi-vorog-obstrilyav-na-harkivshini-tri-naselenih-punkti-ye-poraneni Over the past day, the enemy shelled three settlements in the Kharkiv region, there are wounded at... https://olds.jp/patagonia-shelled-synchilla-jacket-s4-nonsnow-tag-240101/ Patagonia Shelled Synchilla Jacket S4 Nonsnow Tag | OLDS Jan 1, 2024 - 2024/1/1 Patagonia Shelled Synchilla Jacket Purple Hunt patagoniashelledjacketolds https://wits.worldbank.org/trade/comtrade/en/country/All/year/2021/tradeflow/Exports/partner/IRN/product/071029 Leguminous vegetables, shelled or unshelled, fr exports to Iran, Islamic Rep. |2021 https://blog.organicshop.sk/recepty/311/attachment/hemp-shelled-seeds-planetbio_1-2 hemp-shelled-seeds-planetbio_1 | Organic Blog hempshelledseedsorganicblog https://wits.worldbank.org/trade/comtrade/en/country/OAS/year/2024/tradeflow/Exports/partner/ALL/product/071320 Other Asia, nes Dried chickpeas, shelled exports by country | 2024 | Data other asiaby countrynesdriedchickpeas https://wits.worldbank.org/trade/comtrade/en/country/DNK/year/2024/tradeflow/Exports/partner/ALL/product/071320 Denmark Dried chickpeas, shelled exports by country | 2024 | Data by countrydenmarkdriedchickpeasshelled https://wits.worldbank.org/trade/comtrade/en/country/AUS/year/2021/tradeflow/Exports/partner/ALL/product/071340 Australia Dried lentils, shelled exports by country | 2021 | Data dried lentilsby countryaustraliashelledexports https://staging.thebodyretreat.co.uk/conscious-cooking/green-immune-boosting-soup/attachment/image1-4/ Shelled chickpeas - The Body Retreat the bodyshelledchickpeasretreat https://www.evabazaar.com/shop/evanu0109-walnut-whole-shelled-3382 WALNUT WHOLE SHELLED | EVA walnutwholeshelledeva https://fdanj.nlm.nih.gov/?f%5Bfdanj.adjudicatingcourtjurisdiction%5D%5B%5D=District+of+Massachusetts&f%5Bfdanj.defendantnames%5D%5B%5D=Southland+Pecan+Co.+Inc.&f%5Bfdanj.title%5D%5B%5D=26893.+Misbranding+of+shelled+pecans.+U.+S.+v.+195+1%2F2+Cases+of+Shelled+Pecans.+Decree+of+condemnation.+Product+released+under+bond+for+relabeling.&per_page=10&sort=score+desc Titles: 26893. Misbranding of shelled pecans. U. S. v. 195 1/2 Cases of Shelled Pecans. Decree of... https://superfoods-wholesale.co.uk/product/almonds-flaked/ Almonds Flaked - Shelled & Blanched - Superfoods Wholesale Sep 25, 2025 - Buy bulk flaked almonds online from Superfoods Wholesale. Whole Almonds also available. London collection or UK mainland wide delivery options. almondsflakedshelledblanchedsuperfoods https://wits.worldbank.org/trade/comtrade/en/country/HUN/year/2024/tradeflow/Exports/partner/ALL/product/071320 Hungary Dried chickpeas, shelled exports by country | 2024 | Data by countryhungarydriedchickpeasshelled https://en.lb.ua/news/2022/05/09/14526_russians_shelled_15_settlements.html Russians shelled 15 settlements in Donetsk region At least 31 civilian objects were damaged. russiansshelledsettlementsdonetskregion