https://www.coinspeaker.com/cryptocurrency-market-stabilizes-500-billion-bitcoin-maintains-11000-level/
Cryptocurrency Market Stabilizes at $500 Billion, While Bitcoin Maintains at $11,000 Level -...
Oct 5, 2018 - The price of the leading digital currency keeps growing in value, positively influencing the entire cryptocurrency market.
cryptocurrency marketat 500
https://www.mprnews.org/story/2026/04/12/minnesotas-moose-population-has-stabilized-a-new-effort-seeks-to-grow-their-numbers
Minnesota moose population stabilizes, new effort aims to grow herd | MPR News
The new effort, dubbed the Northern Moose Alliance, seeks to gain insights into the challenges young moose face in surviving their first winter and becoming...
minnesota moose
https://www.egyptindependent.com/us-dollar-price-stabilizes-in-egypt-on-thursday/
US dollar price stabilizes in Egypt on Thursday - Egypt Independent
Jan 26, 2023 - The US dollar price stabilized, on Thursday, January 26, 2023, in banks across the country, recording its lowest price in Banque Misr and the National Bank of...
us dollar priceon thursdaystabilizesegyptindependent
https://www.zawya.com/en/press-release/research-and-studies/uae-sustains-foodservice-growth-as-global-market-stabilizes-signaling-new-sourcing-dynamics-gzdldtmx
UAE sustains Foodservice growth as global market stabilizes, signaling new sourcing dynamics
According to Deloitte, United Arab Emirates sustained global foodservice growth in 2025 and is expected to continue expanding through 2030, as TUTTOFOOD...
global market
https://www.osti.gov/pages/biblio/1893143-water-defect-stabilizes-bi3+-lone-pair-electronic-state-leading-unusual-aqueous-hydration-structure
Water Defect Stabilizes the Bi3+ Lone-Pair Electronic State Leading to an Unusual Aqueous Hydration...
The U.S. Department of Energy's Office of Scientific and Technical Information
https://www.electronicdesign.com/technologies/components/article/21764685/reactance-circuit-stabilizes-photosensor-eliminates-ambient-light-interference
Reactance Circuit Stabilizes Photosensor, Eliminates Ambient Light Interference | Electronic Design
Operation of a silicon photodiode as an optical receiving element is typically accomplished using the reverse-biased mode at a specified bias voltage (Fig....
ambient lightreactancecircuitstabilizesphotosensor
https://www.egyptindependent.com/us-dollar-price-stabilizes-on-wednesday-in-egypt-ahead-cbe-meeting/
US dollar price stabilizes on Wednesday in Egypt ahead CBE meeting - Egypt Independent
Dec 21, 2022 - On Wednesday, December 21, the price of the US dollar stabilized against the Egyptian pound. This happened in most banks operating in Egypt, ahead of a meeting...
us dollar price
https://www.wionews.com/videos/us-dollar-stabilizes-against-major-peers-crude-oil-steady-ahead-of-opec-779737
US Dollar Stabilizes Against Major Peers | Crude Oil Steady Ahead of OPEC+ - Race To Power News
As investors continued to assess President-elect Donald Trump's tariff promises and watched a significant inflation statistic released by the United States...
https://www.tradingview.com/chart/XAUUSD/z5xsIa02-XAU-USD-Gold-Stabilizes-Above-4790-Bullish-Momentum-Building/
XAU/USD | Gold Stabilizes Above $4790, Bullish Momentum Building for OANDA:XAUUSD by...
By analyzing the #Gold chart on the 4H timeframe, we can see that price once again reacted exactly as expected around the $4790 support level. After briefly...
https://www.adexchanger.com/digital-audio-radio/podcasts-in-a-pandemic-listenership-stabilizes-but-ad-budgets-and-indie-shows-are-under-pressure/
Podcasts In A Pandemic: Listenership Stabilizes But Ad Budgets And Indie Shows Are Under Pressure |...
Apr 25, 2020 - The podcast industry has been on a crazy ride for the past month and a half. As people spend more time at home, listeners are still gravitating toward their...
https://cryptobriefing.com/bitcoin-long-term-holders-stop-panic-selling-market-stabilizes/
Bitcoin long-term holders stop panic selling, market stabilizes
Apr 25, 2026 - Bitcoin long-term holders stop panic selling, stabilizing the market. Dip to $60,000 in April at 0.1% YES.
long termpanic sellingbitcoinholdersstop
https://www.pew.org/en/research-and-analysis/reports/2005/07/21/support-for-keeping-troops-in-iraq-stabilizes-more-say-iraq-war-hurts-fight-against-terrorism
Support for Keeping Troops in Iraq Stabilizes; More Say Iraq War Hurts Fight Against Terrorism |...
https://aviationweek.com/air-transport/airlines-lessors/american-airlines-operation-stabilizes-following-multi-day
American Airlines Operation Stabilizes Following Multi-Day Disruption | Aviation Week
The Fort Worth-based airline canceled 2,570 flights systemwide from Oct. 29 through mid-day Nov. 2, or about 10% of scheduled flights.
american airlinesmulti dayoperationstabilizesfollowing
https://www.spokesman.com/stories/2017/aug/26/rate-of-meth-use-in-montana-drunken-driving-cases-/
Rate of meth use in Montana drunken-driving cases stabilizes
The Montana State Crime Laboratory says the rate of methamphetamine use in drunken-driving cases stabilized last year after several years of increases.
meth usedrunken drivingratemontanacases
https://audioboom.com/posts/8713746-newworldreport-ecuador-stabilizes-latin-american-research-professor-evan-ellis-u-s-army-war
The John Batchelor Show / #NEWWORLDREPORT: ECUADOR STABILIZES. LATIN AMERICAN RESEARCH PROFESSOR...
#NEWWORLDREPORT: ECUADOR STABILIZES. LATIN AMERICAN RESEARCH PROFESSOR EVAN ELLIS, U.S. ARMY WAR COLLEGE STRATEGIC STUDIES INSTITUTE. @REVANELLIS...
the john batchelor showlatin american
https://www.medicaldaily.com/childhood-obesity-epidemic-stabilizes-are-kids-starting-eat-healthy-and-exercise-256864
Childhood Obesity Epidemic Stabilizes: Are Kids Starting To Eat Healthy And Exercise?
Sep 25, 2013 - A recent study claims that national child obesity rates could be leveling off.
childhood obesity
https://www.themoscowtimes.com/2025/02/24/ruble-stabilizes-but-long-term-strength-depends-on-sanctions-relief-a88136
Ruble Stabilizes But Long-Term Strength Depends on Sanctions Relief - The Moscow Times
May 9, 2026 - After collapsing to 100 to the dollar last summer, the Russian ruble has recovered a lot of ground and has now settled at a relatively strong level of 90 to...
https://www.fox29.com/news/dow-climbs-456-points-as-oil-stabilizes-and-small-business-funding-nears
Dow climbs 456 points as oil stabilizes and small business funding nears | FOX 29 Philadelphia
https://www.nist.gov/news-events/news/2016/07/new-model-may-help-solve-mystery-how-lithium-stabilizes-moods
New Model May Help Solve the Mystery of How Lithium Stabilizes Moods | NIST
Feb 3, 2025 - New measurements may have lifted the veil on the vexingly elusive interactions through which lithium can moderate the manic highs and debilitating lows exper
https://pmc.ncbi.nlm.nih.gov/articles/PMC5138228/
Low-Dose Lithium Stabilizes Human Endothelial Barrier by Decreasing MLC Phosphorylation and...
Lithium at serum concentrations up to 1 mmol/L has been used in patients suffering from bipolar disorder for decades and has recently been shown to reduce the...
low dose
https://www.newswire.com/news/flexible-work-expands-as-hiring-stagnates-and-affordability-pressures-22726503
Flexible Work Expands as Broader Market Stabilizes | Newswire
flexible workexpandsmarketstabilizesnewswire
https://www.romania-insider.com/inflation-romania-october-2025
Inflation in Romania stabilizes at just under 10% in October | Romania Insider
Nov 12, 2025 - The annual inflation rate in Romania in October 2025 was 9.8%, with non-food goods increasing in price by 10.96%, services by 10.52%, and food goods by 7.57%,...
inflation in romaniaunder 10stabilizesoctoberinsider
https://www.frontiersin.org/journals/oncology/articles/10.3389/fonc.2019.00923/full
Frontiers | The Stapled Peptide PM2 Stabilizes p53 Levels and Radiosensitizes Wild-Type p53 Cancer...
The tumor suppressor p53 is a key mediator of cellular stress and DNA damage response cascades and is activated after exposure to ionizing radiation. Amplify...
https://cryptobriefing.com/us-iran-ceasefire-stabilizes-energy-prices-strait-of-hormuz-reopens/
US-Iran ceasefire stabilizes energy prices, Strait of Hormuz reopens
Apr 13, 2026 - A conditional two-week ceasefire between the US and Iran has stabilized energy prices temporarily. The ceasefire, announced by President Trump, has US-Iran ceas
strait of hormuzenergy pricesusiranceasefire
https://bitcoinist.com/bitcoin-stabilizes-68k-fund-flow-ratios-signal/
Bitcoin Stabilizes At $68K as Fund Flow Ratios Signal An Institutional Standstill | Bitcoinist.com
Feb 26, 2026 - Bitcoin tests $69K resistance as February spot volumes hit 2024 lows, signaling weak conviction and a defensive market environment.
https://pmc.ncbi.nlm.nih.gov/articles/PMC6686057/
Maternal Multiple Micronutrient Supplementation Stabilizes Mitochondrial DNA Copy Number in...
The Supplementation with Multiple Micronutrients Intervention Trial (SUMMIT) in Lombok, Indonesia showed that maternal multiple micronutrients (MMN), as...
mitochondrial dna copy numbermicronutrient supplementationmaternalmultiplestabilizes
https://www.israelnationalnews.com/news/233366
Yavneh stabbing victim's condition stabilizes | Israel National News
Doctors say condition of man stabbed by terrorist yesterday at Yavneh supermarket is stable - but still serious.
yavnehstabbingvictimconditionstabilizes
https://www.ig.com/uk/news-and-trade-ideas/eur-usd--gbp-usd-in-process-of-topping-out-while-eur-gbp-stabili-240909
EUR/USD, GBP/USD look toppish while EUR/GBP stabilizes | Levels to Watch - IG UK
EUR/USD, GBP/USD could be in process of topping out after US non-farm payrolls as EUR/GBP sees a minor bounce.
eur usd
https://www.kitco.com/news/article/2026-05-05/gold-stabilizes-oil-eases-equities-close-records-after-mixed-us-data-kitco
Gold stabilizes as oil eases, equities close at records after mixed U.S. data - Kitco PM Report |...
The Kitco News Team brings you the latest news, videos, analysis and opinions regarding Precious Metals, Crypto, Mining, World Markets and Global Economy.
https://www.globaltimes.cn/page/202312/1304089.shtml
China-Europe Railway Express stabilizes global supply chains amid security concerns in Red Sea -...
As attacks on ships along the key Red Sea shipping route continue to affect global maritime commerce, some Chinese exporters are shifting to China-Europe...
china europe railway express
https://openreview.net/forum?id=MLT9wFYMlJ9
Why Spectral Normalization Stabilizes GANs: Analysis and Improvements | OpenReview
We study theoretically how spectral normalization stabilizes GANs.
spectralnormalizationstabilizesgansanalysis
https://cyprus-mail.com/2025/07/13/mutuum-finance-mutm-set-to-double-as-bitcoin-btc-stabilizes-only-a-few-days-left-at-0-03-pricing
Mutuum Finance (MUTM) set to double as Bitcoin (BTC) stabilizes, only a few days left at $0.03...
Jul 13, 2025 - With Bitcoin (BTC) now showing signs of stabilization, seasoned crypto traders are anticipating what always follows: the beginning of altseason. Historically,...
https://www.imf.org/en/news/articles/2015/09/28/04/53/socar022014a
IMF Survey : India: Economy Stabilizes, but High Inflation, Slow Growth Key Concerns
India has restored macroeconomic and financial stability, but structural impediments to growth and persistently high inflation remain key concerns, the IMF...
india economy
https://www.post-gazette.com/sports/duquesne/2004/03/16/basketball-nee-stabilizes-duquesne/stories/200403160155
Basketball: Nee stabilizes Duquesne | Pittsburgh Post-Gazette
DAYTON, Ohio -- After spending the past two decades taking huge strides backward, Duquesne University's basketball program finally made
pittsburgh postbasketballneestabilizesduquesne
https://www.financialcontent.com/article/marketminute-2026-4-2-us-inflation-stabilizes-at-21-as-economy-defies-gravity-fed-eyes-late-2026-pivot
US Inflation Stabilizes at 2.1% as Economy Defies Gravity; Fed Eyes Late-2026 Pivot |...
Fresh macroeconomic data released this morning, April 2, 2026, confirms that the long-awaited stabilization of the U.S. economy has finally arrived. Headline...
https://www.jpost.com/breaking-news/article-743188
Wagner advances in Bakhmut, but Ukraine stabilizes flanks - UK | The Jerusalem Post
https://pmc.ncbi.nlm.nih.gov/articles/PMC11605888/
Inhibition of the E3 ligase UBR5 stabilizes TERT and protects vascular organoids from oxidative...
Excessive oxidative stress is known to cause endothelial dysfunction and drive cardiovascular diseases (CVD). While telomerase reverse transcriptase (TERT)...
https://decrypt.co/246759/bitcoin-price-stabilizes-after-sharp-drop-rocks-market
Bitcoin Price Stabilizes After Sharp Drop Rocks Market - Decrypt
Aug 28, 2024 - Analysts said the drop indicates traders might have been overconfident in the remarks made by Fed Chair Jerome Powell last week.
bitcoin pricestabilizessharpdroprocks
https://www.pew.org/da/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://decrypt.co/324246/bitcoin-death-cross-ethereum-stabilizes-fartcoin
Bitcoin Avoids Death Cross, Ethereum Stabilizes and Fartcoin Defies Gravity: Analysis - Decrypt
Jun 9, 2025 - Technical indicators signal potential rebounds for Bitcoin and Ethereum while Fartcoin meme coin momentum accelerates.
death cross
https://www.ktvu.com/news/covid-19-level-stabilizes-in-california-but-latinos-and-blacks-face-concerns
COVID-19 level stabilizes in California, but Latinos and Blacks face concerns | KTVU FOX 2
Authorities say COVID-19 infections in California are stable, but Latinos and African Americans experience more negative effects from the outbreak.
https://www.uchicagomedicine.org/forefront/heart-and-vascular-articles/hybrid-cardiac-ablation-stabilizes-heart-rhythm
Hybrid cardiac ablation stabilizes man's heart rhythm - UChicago Medicine
When Californian Shawn Carter recurring ventricular tachycardia (VT) became life-threatening, he was airlifted to UChicago Medicine for a totally endoscopic...
man s heartcardiac ablationhybridstabilizesrhythm
https://www.infoq.com/news/2021/03/rust-1-51-released/
Rust 1.51 Stabilizes Const Generics MVP, Improves Cargo and Compile Times - InfoQ
Rust 1.51 brings to stable a minimum value proposition for const generics, which enable parametrizing types by constant values, for example integers, as...
https://www.foxbusiness.com/markets/oil-stabilizes-while-waiting-for-iran-deal
Oil Stabilizes While Waiting for Iran Deal | Fox Business
Oil prices came off their lows on Monday after a Tehran official indicated the Islamic Republic might miss another deadline in securing a nuclear deal integral...
while waitingiran dealoilstabilizesfox
https://www.prnewswire.com/news-releases/velocity-stabilizes-restomod-industry-with-the-acquisition-of-classic-recreations-302527462.html
VELOCITY STABILIZES RESTOMOD INDUSTRY WITH THE ACQUISITION OF CLASSIC RECREATIONS
/PRNewswire/ -- Velocity, an industry leader in classic vehicle modernization, announced today its acquisition of the key assets of Classic Recreations,...
with thevelocitystabilizesrestomodindustry
https://www.ainonline.com/aviation-news/defense/2025-06-18/airbus-stabilizes-a400m-production
Airbus Stabilizes A400M Airlifter Production | Aviation International News
Airbus Defence and Space outlines its product line progress
airbusstabilizesa400mairlifterproduction
https://decrypt.co/10087/bitcoin-stabilizes-between-8100-and-8200-after-yesterdays-recovery
Bitcoin stabilizes between $8,100 and $8,200 after yesterday's recovery - Decrypt
Oct 8, 2019 - After dropping below $8,000 over the weekend, Bitcoin has found that sweet (and boring) spot of calm after the storm.
https://www.sciencedaily.com/releases/2023/03/230331131453.htm
A tighter core stabilizes SARS-CoV-2 spike protein in new emergent variants | ScienceDaily
New research reveals that mutations in the stem of the SARS-CoV-2 spike protein led to the virus becoming progressively tighter over time, which may have...
sars cov 2 spike protein
https://www.pew.org/ja/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://www.egyptindependent.com/us-dollar-price-stabilizes-in-egypt-thursday-2/
US dollar price stabilizes in Egypt Thursday - Egypt Independent
Mar 23, 2023 - The price of the US dollar stabilized against the Egyptian pound, at the beginning of trading, Thursday, March 23, the first day of Ramadan, in the Central...
us dollar pricestabilizesegyptthursdayindependent
https://www.thestandard.com.hk/news/article/331171/Hong-Kong-family-wellbeing-stabilizes-but-loneliness-crisis-deepens-survey-reveals
Hong Kong family wellbeing stabilizes, but loneliness crisis deepens, survey reveals
While the overall well-being of Hong Kong families has stopped its recent decline, a new comprehensive survey has uncovered a deepening crisis of loneliness,...
hong kongfamily wellbeingstabilizes
https://elifesciences.org/reviewed-preprints/92420
Itaconate stabilizes CPT1a to enhance lipid utilization during inflammation
itaconatestabilizescpt1aenhancelipid
https://www.taipeitimes.com/News/biz/archives/2013/08/04/2003568856
China stabilizes as services pick up - Taipei Times
Aug 4, 2013 - Bringing Taiwan to the World and the World to Taiwan
pick upchinastabilizesservicestaipei
https://www.pnc.com/insights/corporate-institutional/gain-market-insight/healthcare-industry-in-2025-stabilizes-amidst-challenges.html
Healthcare Industry in 2025: Stabilizes Amidst Challenges | PNC Insights
Understand the 2025 stabilization of the healthcare industry in our in-depth analysis, highlighting labor pressures, technology, and policy changes.
healthcare industry2025stabilizesamidstchallenges
https://www.marketscreener.com/news/oil-stabilizes-at-under-100-as-us-iran-talks-in-focus-ce7e50d9db8df32d
Oil Stabilizes at Under $100 as US-Iran Talks in Focus | MarketScreener
Apr 10, 2026 - Oil prices stabilized at under $100 a barrel on Friday ahead of US-Iran talks in Pakistan as markets sought clarity on whether this weekend's huddle in...
us iran talksunder 100
https://gripsheet-endupack.co.uk/
Anti-slip paper stabilizes your loads | Endupack SA
This unique anti-slip paper made by Endupack is called a Grip Sheet. Endupack offers several non-slip solutions for your shipping needs.
anti slippaperstabilizesloadssa
https://www.egyptindependent.com/vanuatu-island-exodus-continues-even-volcano-stabilizes/
Vanuatu island exodus continues even as volcano stabilizes - Egypt Independent
Oct 2, 2017 - The evacuation of a Vanuatu island was continuing on Monday even after scientists said an erupting volcano had stabilized. A makeshift fleet of vessels ranging...
vanuatuislandexoduscontinueseven
https://www.rcsb.org/structure/4FGT
RCSB PDB - 4FGT: Allosteric peptidic inhibitor of human thymidylate synthase that stabilizes...
Allosteric peptidic inhibitor of human thymidylate synthase that stabilizes inactive conformation of the enzyme.
rcsb pdb
https://www.pew.org/zh/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://www.mdpi.com/1422-0067/23/9/4913
Long-Term Heat Selection of the Coral Endosymbiont Cladocopium C1acro (Symbiodiniaceae) Stabilizes...
Heat-tolerant strains of the coral endosymbiont, Cladocopium C1acro (Symbiodiniaceae), have previously been developed via experimental evolution. Here, we...
long termof the
https://www.pewresearch.org/religion/2025/02/26/decline-of-christianity-in-the-us-has-slowed-may-have-leveled-off/pr_2025-02-26_religious-landscape-study_0-01/
After years of decline, the Christian share of the U.S. population stabilizes | Pew Research Center
https://www.pew.org/nb/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://www.digitimes.com/bits_chips/a20070108PB205.html
Rumors of Hynix DDR output reduction stabilizes prices
Industry players attribute the recent stable DDR pricing on the spot market to a speculated reduction of output from Hynix Semiconductor.
rumorshynixddroutputreduction
https://www.jci.org/articles/view/122533
JCI - PLK1 stabilizes a MYC-dependent kinase network in aggressive B cell lymphomas
https://www.pew.org/ar/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://www.electronicdesign.com/markets/energy/article/21776815/tiny-controller-stabilizes-power-grids
Tiny Controller Stabilizes Power Grids | Electronic Design
An IC developed by the Pacific Northwest National Laboratory can sense disruptions in a power grid and respond in a quarter of a second to temporarily shut off...
power gridstinycontrollerstabilizeselectronic
https://www.biospace.com/anti-amyloid-drug-stabilizes-cognitive-function-in-mild-to-moderate-alzheimer-s5215
Anti-amyloid Drug Stabilizes Cognitive Function In Mild-to-Moderate Alzheimer's - BioSpace
https://www.fxempire.com/forecasts/article/us-dollar-forecast-dxy-stabilizes-but-risk-on-keeps-pressure-intact-1592304
US Dollar Forecast: DXY Stabilizes but Risk-On Keeps Pressure Intact | FXEmpire
The US Dollar Index falls for a second week as risk sentiment improves. Traders unwind safe-haven trades while DXY tests key retracement levels.
us dollar forecast
https://www.wikidata.org/wiki/Q71988142
An intermolecular disulfide bond stabilizes E2A homodimers and is required for DNA binding at...
scientific article published on 01 December 1994
https://elifesciences.org/articles/67282v1/figures
Figures and data in SSNA1 stabilizes dynamic microtubules and detects microtubule damage | eLife
https://www.phillyvoice.com/new-jersey-coronavirus-new-covid-19-patients-stabilizes-hospitalizations-covid-19/
Coronavirus in New Jersey: Number of new COVID-19 patients stabilizes as curve continues to flatten...
Apr 21, 2020 - New Jersey is seeing "relative stability" in the daily number of new coronavirus cases, Gov. Phil Murphy said. "This doesn't mean that we aren't going to see...
https://www.accessnewswire.com/newsroom/en/business-and-professional-services/smx-stabilizes-prices-in-a-volatile-world-verified-recycled-plas-1150594
SMX Stabilizes Prices in a Volatile World: Verified Recycled Plastics Keep Costs - and Shelf Prices...
NEW YORK, NY / ACCESS Newswire / March 23, 2026 / SMX (Security Matters) PLC (NASDAQ:SMX) is redefining price stability in consumer markets by proving that...
https://www.egyptindependent.com/us-dollar-price-stabilizes-in-egypt-on-friday/
US dollar price stabilizes in Egypt on Friday - Egypt Independent
Jan 20, 2023 - On Friday, January 20, the price of the US dollar stabilized against the Egyptian pound in the Central Bank of Egypt and Egyptian banks. The price of the...
us dollar pricestabilizesegyptfridayindependent
https://www.zawya.com/en/press-release/events-and-conferences/uae-sustains-foodservice-growth-as-global-market-stabilizes-signaling-new-sourcing-dynamics-ttgrxny5
UAE sustains Foodservice growth as global market stabilizes, signaling new sourcing dynamics
According to Deloitte, UAE sustained global foodservice growth in 2025 and is expected to continue expanding through 2030, as TUTTOFOOD reinforces its role as...
global market
https://www.rcsb.org/structure/5M35
RCSB PDB - 5M35: The molecular tweezer CLR01 stabilizes a disordered protein-protein interface
The molecular tweezer CLR01 stabilizes a disordered protein-protein interface
rcsb pdbmolecular tweezer
https://nairametrics.com/2023/05/15/crypto-markets-focus-remains-on-memecoins-as-bitcoin-stabilizes-around-27000/
Crypto market's focus remains on Memecoins as Bitcoin stabilizes around $27,000 - Nairametrics
May 15, 2023 - Article Summary Bitcoin and major altcoins remain rangebound as the market focuses on meme-coins, leading to soaring transaction fees on
https://www.businesswire.com/news/home/20260420248174/en/U.S.-Office-Market-Stabilizes-as-Demand-Concentrates-in-Leading-Markets-and-Supply-Continues-to-Contract
U.S. Office Market Stabilizes as Demand Concentrates in Leading Markets and Supply Continues to...
The U.S. office market is beginning to stabilize, with improving demand, flat vacancy and a sharp pullback in new supply signaling a shift from broad-based d...
https://www.pew.org/en/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://www.theepochtimes.com/article/international-student-numbers-in-us-reach-all-time-high-decline-in-new-enrollments-stabilizes-3149681
International Student Numbers in US Reach All-Time High, Decline in New Enrollments Stabilizes |...
all time high
https://pmc.ncbi.nlm.nih.gov/articles/PMC5093072/
A Phosphomimetic Mutation Stabilizes SOD1 and Rescues Cell Viability in the Context of an...
The majority of amyotrophic lateral sclerosis (ALS)-related mutations in the enzyme Cu, Zn superoxide dismutase (SOD1), as well as a post-translational...
https://www.pew.org/ru/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://cryptobriefing.com/boj-intervenes-in-forex-market-amid-us-iran-tensions-yen-stabilizes/
BOJ intervenes in forex market amid US-Iran tensions, yen stabilizes
May 4, 2026 - BOJ intervenes in forex market amid US-Iran tensions. Fed rate cut by June 2026 at 3.6% YES.
forex marketbojintervenes
https://www.edsurge.com/news/2014-02-07-2013-k-12-budgets-for-tech-purchases-stabilizes
2013 K-12 Budgets for Tech Purchases Stabilizes | EdSurge News
Dec 27, 2018 - MORE MONEY AND DEVICES: The financial outlook for tech adoption in K-12 districts appears to be optimistic--for once. According to EdNET Insight's ...
k 12for tech2013budgetspurchases
https://www.miragenews.com/thiol-biochar-stabilizes-mercury-in-extreme-1656245/
Thiol Biochar Stabilizes Mercury in Extreme Climates | Mirage News
As climate change intensifies heatwaves around the world, soils are increasingly exposed to repeated drying and rewetting cycles that can mobilize
thiolbiocharstabilizesmercuryextreme
https://elifesciences.org/articles/42675v1
The Hox transcription factor Ubx stabilizes lineage commitment by suppressing cellular plasticity...
transcription factor
https://www.industryweek.com/the-economy/article/21982325/world-steel-production-stabilizes-in-august
World Steel Production Stabilizes in August | IndustryWeek
Global steel production totaled 134.1 million metric tons during August, rising only 0.2% from the July result and 1.95% more than the August 2015 figure....
steel productionin augustworldstabilizesindustryweek
https://elifesciences.org/articles/08998
Attention stabilizes the shared gain of V4 populations | eLife
Populations of neurons in the macaque visual cortex are subject to shared fluctuations in gain; these signals exhibit anatomical and functional structure, and...
attentionstabilizessharedgainv4
https://www.weforum.org/videos/the-global-economy-is-settling-into-a-better-equilibrium-says-this-world-bank-expert/
World Bank economist: Global economy stabilizes for 2025 | World Economic Forum
World Bank economist Indermit Gill highlights global economic stability, slower growth trends, and hopeful resilience in emerging economies for a balanced 2025...
world bankglobal economyeconomiststabilizes2025
https://www.overleaf.com/articles/adaptive-learning-rate-clipping-stabilizes-learning/tssrqcwknfch
Adaptive Learning Rate Clipping Stabilizes Learning - Overleaf, Online LaTeX Editor
Adaptive learning rate clipping (ALRC) stabilizes learning by limiting backpropagated losses.
adaptive learning rateclippingstabilizesoverleafonline
https://www.pew.org/pt/research-and-analysis/articles/2026/04/02/state-tax-revenue-stabilizes-amid-rising-fiscal-uncertainty
State Tax Revenue Stabilizes Amid Rising Fiscal Uncertainty | The Pew Charitable Trusts
After five years of widespread volatility, state tax revenue growth fell more in line with historical norms in fiscal year 2025. Even so, collections remained...
state tax
https://augustafreepress.com/news/gas-prices-marginally-lower-as-opec-deal-stabilizes-market/
Gas prices marginally lower as OPEC deal stabilizes market
May 7, 2025 - Virginia gas prices have fallen 2.5 cents per gallon in the past week, averaging $1.78/g today, according to GasBuddy's daily survey of 4,081 stations.
gas pricesmarginallyloweropecdeal
https://www.rferl.org/a/putin-covid-urges-russians-vaccinated-situation-stabilizes/31247821.html
Putin Urges Russians To Get Vaccinated As COVID Situation Stabilizes
President Vladimir Putin says that almost 21.5 million people in Russia have been vaccinated against COVID-19 and encouraged Russians push the number higher in...
to getputinurgesrussiansvaccinated
https://cryptobriefing.com/china-backed-ceasefire-stabilizes-iran-amid-regime-change-speculation/
China-backed ceasefire stabilizes Iran amid regime change speculation
Apr 26, 2026 - Iran's regime fall odds rise slightly to 8.5% as a China-backed ceasefire stabilizes the situation. Regime fall by June 30 at 8.5% YES.
regime changechinabackedceasefirestabilizes
https://appleinsider.com/articles/14/12/23/survey-shows-demand-for-apples-iphone-6-still-growing-as-supply-stabilizes
Survey shows demand for Apple's iPhone 6 still growing as supply stabilizes | AppleInsider
Apple's new, larger-screened iPhones are even more popular now than they were when they were announced, according to survey data released Tuesday, boding well...
https://www.bworldonline.com/editors-picks/2023/08/22/540760/lionsgate-play-stabilizes-subscriber-base-in-southeast-asia/
LIONSGATE Play stabilizes subscriber base in Southeast Asia - BusinessWorld Online
Aug 21, 2023 - LIONSGATE Play, the global streaming service of entertainment company Lionsgate, is planning to stabilize its subscriber base in Southeast Asia this 2023 by...
lionsgate playsoutheast asiastabilizessubscriberbase
https://emergentphysics.com/
Emergent Physics | Reality Emerges Where Energy Stabilizes
emergentphysicsrealityenergystabilizes
https://www.ambest.com/video/MediaArchive.aspx?lid=1068187772001&vid=6367190056112
PRMA Executive Director: Reinsurance Market Stabilizes in 2024 Amid Rising Risks, Innovation
Private Risk Management Association Executive Director Diane Delaney discusses the reinsurance marketchr(39)s stabilization in 2024 and how ongoing challenges...
executive directorreinsurance market
https://www.iata.org/en/pressroom/pressroom-archive/2005-releases/2005-12-29-02/
IATA - Freight Remains Weak as Passenger Traffic Stabilizes
IATA announced traffic results to the end of November 2005
iatafreightremainsweakpassenger
https://www.uc.edu/news/articles/2026/03/dual-arm-robot-stabilizes-satellite-for-repairs-in-space.html
Dual-arm robot stabilizes satellite for repairs in space | University of Cincinnati
Mar 13, 2026 - Interesting Engineering highlights an aerospace engineering research project examining novel ways to keep repair robots oriented in space.
arm robot
https://www.tomshardware.com/news/dram-nand-flash,18927.html
Early November 2012 DRAM Prices Decline, Flash Stabilizes | Tom's Hardware
Nov 8, 2012 - DRAM is beginning the week with another decline and no signs of price stabilization.
early novembertom s2012dramprices