Robuta

https://pghtastebuds.com/ Pittsburgh TasteBuds – Taste buds are flavor receptors. taste budspittsburghtastebudsflavorreceptors https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2024.1490035/full Frontiers | Alternative splicing of modulatory immune receptors in T lymphocytes: a newly... Alternative splicing (AS) is a mechanism that generates translational diversity within a genome. Equally important is the dynamic adaptability of the splicin... https://pubchem.ncbi.nlm.nih.gov/bioassay/1346419 AID 1346419 - Rat SST2 receptor (Somatostatin receptors) - PubChem BioAssay record AID 1346419 submitted by IUPHAR/BPS Guide to PHARMACOLOGY: Rat SST2 receptor (Somatostatin receptors). somatostatin receptorsaidratpubchem https://journals.ed.ac.uk/gtopdb-cite/article/view/11719/14108 View of Neuropeptide Y receptors in GtoPdb v.2025.3 viewneuropeptidereceptors https://www.wikidata.org/wiki/Q66887136 Receptors for sheep erythrocytes (E) and erythrocyte-antibody-complement complexes (EAC) on the... scientific article published on 01 January 1976 https://pubmed.ncbi.nlm.nih.gov/20520935/ Histamine, histamine receptors and antihistamines: new concepts Drugs with antihistamine action are the most commonly prescribed medication in daily dermatologic practice, both to adults and children. This article addresses... histamine receptorsantihistaminesnewconcepts https://pubmed.ncbi.nlm.nih.gov/18774293/ Phagosome maturation during the removal of apoptotic cells: receptors lead the way In metazoan organisms, cells undergoing apoptosis are rapidly engulfed and degraded by phagocytes. Defects in apoptotic-cell clearance result in inflammatory... maturationremoval https://pubmed.ncbi.nlm.nih.gov/8114680/ Pharmacological characterization of the cloned kappa-, delta-, and mu-opioid receptors Opioid drugs, such as morphine, and the endogenous opioid peptides, namely the enkephalins, endorphins, and dynorphins, exert a wide spectrum of physiological... of thekappa deltapharmacologicalcharacterizationcloned https://researchconnect.buffalo.edu/en/publications/expression-and-role-of-epidermal-growth-factor-receptors-during-d/ Expression and role of epidermal growth factor receptors during differentiation of cementoblasts,... epidermal growth factorexpressionrole https://pubmed.ncbi.nlm.nih.gov/15451779/ Endocannabinoids acting at cannabinoid-1 receptors regulate cardiovascular function in hypertension We conclude that endocannabinoids tonically suppress cardiac contractility in hypertension and that enhancing the CB1-mediated cardiodepressor and vasodilator... endocannabinoidsacting https://nephrology.wustl.edu/tag/tumor-necrosis-factor-receptors/ Tumor Necrosis Factor receptors Archives - Division of Nephrology tumor necrosis factorarchives divisionreceptorsnephrology https://www.frontiersin.org/research-topics/19680/regulation-of-ampa-receptors-from-the-genetic-to-the-functional-level/magazine Regulation of AMPA Receptors, from the genetic to the functional level | Frontiers Research Topic https://experts.umn.edu/en/publications/roundabout-receptors-are-critical-for-foregut-separation-from-the/ Roundabout Receptors Are Critical for Foregut Separation from the Body Wall - Experts@Minnesota https://pubmed.ncbi.nlm.nih.gov/32971845/?dopt=Abstract Quantitative Analysis of Somatostatin and Dopamine Receptors Gene Expression Levels in... The primary treatment for non-functioning pituitary tumors (NFPTs) is surgery, but it is often unsuccessful. Previous studies have reported that NFPTs express... quantitative analysisdopamine receptorsgene expressionsomatostatin https://tobias-lib.ub.uni-tuebingen.de/xmlui/handle/10900/124711 Arabidopsis ADR1 helper NLR immune receptors localize and function at the plasma membrane in a... https://www.techtransfer.nih.gov/patent/e-009-1994-2-us-01 Method For Modulating Processes Mediated by Farnesoid Activated Receptors | Technology Transfer methodprocessesmediated https://scholars.duke.edu/publication/753084 Scholars@Duke publication: Excitatory amino acid receptors and epilepsy. amino acidscholarsdukepublicationreceptors https://pmc.ncbi.nlm.nih.gov/articles/PMC1762120/ Effect of low frequency electromagnetic fields on A2A adenosine receptors in human neutrophils - PMC The present study describes the effect of low frequency, low energy, pulsing electromagnetic fields (PEMFs) on A2A adenosine receptors in human neutrophils.... https://meetings-archive.aps.org/mar/2018/b47/9/ Generation Probabilities of T cell receptors: a story of Coarse Graining - DPOLY Short Course: The... The adaptive immune system operates by stochastically generating a large repertoire of unique receptors to tag foreign peptides through specific binding affinit https://pubmed.ncbi.nlm.nih.gov/36813357/ Prion receptors, prion internalization, intra- and inter-cellular transport Prion receptors, prion internalization, intra- and inter-cellular transport prionreceptorsinternalizationintracellular https://www.techtransfer.nih.gov/patent/e-008-2014-2-gb-13 Thymic Stromal Lymphopoietin Receptor-Specific Chimeric Antigen Receptors and Methods Using Same |... https://cordis.europa.eu/project/id/220596/results/it Dissecting pathogen recognition complexes of Toll-like receptors: hunting for new co-receptors and... Deliverables, publications, datasets, software, exploitable results https://pubmed.ncbi.nlm.nih.gov/10973284/ APRIL and TALL-I and receptors BCMA and TACI: system for regulating humoral immunity We report that the tumor neurosis factor homolog APRIL (a proliferation-inducing ligand) stimulates in vitro proliferation of primary B and T cells and... https://pubmed.ncbi.nlm.nih.gov/10820264/ Soluble NSF attachment protein receptors (SNAREs) in RBL-2H3 mast cells: functional role of... Mast cells upon stimulation through high affinity IgE receptors massively release inflammatory mediators by the fusion of specialized secretory granules... https://scholars.lib.ntu.edu.tw/entities/project/09c9fe36-cda3-47a8-b527-2d372705c519 Serum Level of Toll Like Receptors Ligands and Lipid Peroxidation Products in Young Adult Patients... https://bibliographie.uni-tuebingen.de/xmlui/handle/10900/41383 Molecular determinants of PI3K gamma-mediated activation downstream of G-protein-coupled receptors... https://www.techtransfer.nih.gov/patent/e-237-2017-2-mx-13 T CELL RECEPTORS RECOGNIZING MUTATED P53 | Technology Transfer t cell receptorsrecognizingmutatedtechnologytransfer https://openresearch-repository.anu.edu.au/items/ebb3d57d-88cb-4d4e-976e-d375bd5a1d45 Some recently discovered underwater vibration receptors in invertebrates recentlydiscoveredunderwatervibrationreceptors https://www.techtransfer.nih.gov/patent/e-106-2006-3-de-09 T Cell Receptors And Related Materials And Methods Of Use | Technology Transfer t cell receptorsmethods of userelated materials https://openresearch-repository.anu.edu.au/items/0f22f524-216f-43a7-9d7a-c7678c45804c/full CD8 T cells expressing killer Ig-like receptors and NKG2A are present in cord blood and express a... We report that natural killer receptors (NKR) for major histocompatibility complex (MHC) class I molecules (MHC-NKR), the inhibitory killer immunoglobulin-like... https://www.ideals.illinois.edu/items/85555 Part I. The Synthesis and Study of Luminescent Polyglycerol Dendrimers. Part II. Adenine Receptors... https://www.techtransfer.nih.gov/patent/e-230-2012-0-pct-02 T Cell Receptors Recognizing MHC Class II-Restricted Mage-A3 | Technology Transfer t cell receptorsclass ii https://www.techtransfer.nih.gov/patent/e-269-2010-0-il-12 ANTI-SSX-2 T CELL RECEPTORS AND RELATED MATERIALS AND METHODS OF USE | Technology Transfer https://research.monash.edu/en/publications/functional-cooperation-of-mitochondrial-protein-import-receptors-/ Functional cooperation of mitochondrial protein import receptors in yeast - Monash University functionalcooperationmitochondrialprotein https://pubmed.ncbi.nlm.nih.gov/28077487/ Calcium-permeable AMPA receptors and silent synapses in cocaine-conditioned place preference Exposure to cocaine generates silent synapses in the nucleus accumbens (NAc), whose eventual unsilencing/maturation by recruitment of calcium-permeable... ampa receptors https://www.ipmc.cnrs.fr/fr/publication/mglu5-receptors-regulate-synaptic-sumoylation-via-a-transient-pkc-dependent-diffusional-trapping-of-ubc9-into-spines/ mGlu5 receptors regulate synaptic sumoylation via a transient PKC-dependent diffusional trapping of... https://experts.arizona.edu/en/publications/high-affinity-specific-sup3suph-pn-200-110-binding-to-dihydropyri/ High affinity specific [3H] (+)PN 200-110 binding to dihydropyridine receptors associated with... https://experts.umn.edu/en/publications/type-1-diabetes-pathogenesis-and-the-role-of-inhibitory-receptors/ Type 1 diabetes pathogenesis and the role of inhibitory receptors in islet tolerance -... https://journals.ed.ac.uk/gtopdb-cite/article/view/3186/4179 View of Histamine receptors (version 2019.4) in the IUPHAR/BPS Guide to Pharmacology Database https://pubmed.ncbi.nlm.nih.gov/41462474/ Correction: Overcoming acquired resistance to cetuximab by dual targeting HER family receptors with... Correction: Overcoming acquired resistance to cetuximab by dual targeting HER family receptors with antibody-based therapy https://portal.fis.tum.de/de/publications/new-affinity-probe-targeting-vegf-receptors-for-kinase-inhibitor-/ New affinity probe targeting VEGF receptors for kinase inhibitor selectivity profiling by chemical... https://eprints.ncl.ac.uk/214764 Expression of melanocortin receptors in human endometrium - ePrints - Newcastle University melanocortin receptorsexpressionhumanendometriumeprints https://open.library.ubc.ca/soa/cIRcle/collections/ubctheses/831/items/1.0101419 A structural characteriztion of the dog myocardial adrenergic receptors - UBC Library Open... Learning, knowledge, research, insight: welcome to the world of UBC Library, the second-largest academic research library in Canada. of the https://www.techtransfer.nih.gov/patent/e-237-2017-2-kr-12 T CELL RECEPTORS RECOGNIZING MUTATED P53 | Technology Transfer t cell receptorsrecognizingmutatedtechnologytransfer https://www.techtransfer.nih.gov/patent/e-099-2014-0-jp-13 MESOTHELIN-TARGETED CHIMERIC ANTIGEN RECEPTORS AND USES THEREOF | Technology Transfer mesothelintargetedchimericantigenreceptors https://research.monash.edu/en/publications/il-37-requires-the-receptors-il-18ralpha-and-il-1r8-sigirr-to-car/ IL-37 requires the receptors IL-18Ralpha and IL-1R8 (SIGIRR) to carry out its multifaceted... https://www.techtransfer.nih.gov/patent/e-269-2010-0-ep-14 ANTI-SSX-2 T CELL RECEPTORS AND RELATED MATERIALS AND METHODS OF USE | Technology Transfer https://oru.diva-portal.org/smash/record.jsf?faces-redirect=true&language=en&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A1193624&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Gradient-dependent Modulation of Platelet Stimulatory G-protein Coupled Receptors (GPCR) Signaling https://pubmed.ncbi.nlm.nih.gov/12169103/ Differential modulation of I(h) by 5-HT receptors in mouse CA1 hippocampal neurons CA1 pyramidal neurons of the hippocampus express various types of serotonin (5-HT) receptors, such as 5-HT(1A), 5-HT(4) and 5-HT(7) receptors, which couple to... https://www.techtransfer.nih.gov/patent/e-105-2012-0-ca-04 Murine Anti-NY-ESO-1 T Cell Receptors | Technology Transfer t cell receptorsmurineantinyeso https://www.wikidata.org/wiki/Q46499427 Limited heterogeneity of T cell receptors from lymphocytes mediating autoimmune encephalomyelitis... scientific article published in July 1988 t cell receptorslimitedheterogeneity https://www.techtransfer.nih.gov/patent/e-230-2012-0-au-03 T Cell Receptors Recognizing MHC Class II-Restricted Mage-A3 | Technology Transfer t cell receptorsclass ii https://liu.diva-portal.org/smash/record.jsf?pid=diva2:1548700 Targeting the Opioid Receptors : A Promising Therapeutic Avenue for Treatment in "Heavy Drinking... https://liu.diva-portal.org/smash/record.jsf?pid=diva2:266774 Dendritic cells and toll-like receptors 2 and 4 in the ileum of Crohn's disease patients https://publications-cnrc.canada.ca/eng/view/object/?id=2544e5ca-0588-4ac6-bc75-bcc6770d0766 Metabotropic glutamate receptors and visual cortical synaptic plasticity - NRC Publications Archive... Metabotropic glutamate receptors and visual cortical synaptic plasticity synaptic plasticityglutamatereceptorsvisual https://research.birmingham.ac.uk/en/publications/central-5-ht3-receptors-in-p-and-in-aa-alcohol-preferring-rats-an/ Central 5-HT3 receptors in P and in AA alcohol-preferring rats: An autoradiographic study -... https://pubmed.ncbi.nlm.nih.gov/36117326/?dopt=Abstract Activation of the Mas receptors by AVE0991 and MrgD receptor using alamandine to limit the... The MrgD receptor agonist, alamandine (ALA) and Mas receptor agonist, AVE0991 have recently been identified as protective components of the renin-angiotensin... https://www.techtransfer.nih.gov/patent/e-001-2016-0-pct-02 ANTI-CD30 CHIMERIC ANTIGEN RECEPTORS | Technology Transfer antichimericreceptorstechnologytransfer https://journals.ed.ac.uk/gtopdb-cite/article/view/11696/14040 View of Chemokine receptors in GtoPdb v.2025.3 | IUPHAR/BPS Guide to Pharmacology CITE https://www.sciencedaily.com/releases/2015/04/150429234631.htm Scientists identify key receptors behind development of acute myeloid leukemia | ScienceDaily Scientists have discovered that a certain class of receptors that inhibit immune response are crucial for the development of acute myeloid leukemia (AML), the... acute myeloid leukemiascientistsidentifykeyreceptors https://en.lf1.cuni.cz/muscarinic-receptors-in-the-urinary-bladder-by-martin-c-michel Muscarinic Receptors in the Urinary Bladder by Martin C. Michel, - First Faculty of Medicine https://www.ncbi.nlm.nih.gov/books?Db=books&tool=Reference.MD&email=info%40res.ca&Term=%22Receptors,+Ghrelin%22 "Receptors, Ghrelin" - Books - NCBI receptorsghrelinbooksncbi https://scholarshare.temple.edu/entities/publication/4d2b264b-0236-4fb3-b009-781bbe22f492 The SARS-CoV-2 spike protein binds and modulates estrogen receptors The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike (S) protein binds angiotensin-converting enzyme 2 as its primary infection mechanism.... sars covspike protein https://journals.ed.ac.uk/gtopdb-cite/article/view/11724/14124 View of Parathyroid hormone receptors in GtoPdb v.2025.3 | IUPHAR/BPS Guide to Pharmacology CITE https://publications-cnrc.canada.ca/eng/view/object/?id=16e37ee2-bca1-4099-8cd8-5856dc3fef50 On the configuration of the receptors for excitatory amino acids - NRC Publications Archive -... On the configuration of the receptors for excitatory amino acids on the https://dukespace.lib.duke.edu/items/851d09e4-adbf-4019-9597-febc72b3b694 Catecholamines, cardiac beta-adrenergic receptors, and heart failure. adrenergic receptorscatecholaminescardiacbetaheart https://www.wikidata.org/wiki/Q40655752 Properties of macrophage receptors for cytophilic antibodies. - Wikidata scientific article published on April 1966 propertiesmacrophagereceptorsantibodieswikidata https://researchportalplus.anu.edu.au/en/publications/toll-like-receptors-and-cancer-myd88-mutation-and-inflammation/ Toll-like receptors and cancer: MYD88 mutation and inflammation - The Australian National University https://www.techtransfer.nih.gov/patent/e-230-2012-0-kr-69 T Cell Receptors Recognizing MHC Class II-Restricted Mage-A3 | Technology Transfer t cell receptorsclass ii https://scholars.uky.edu/es/publications/nicotinic-cholinergic-receptors-in-the-rat-cerebellum-multiple-he/fingerprints/ Nicotinic cholinergic receptors in the rat cerebellum: Multiple heteromeric subtypes - Huella - in thecholinergicreceptors https://shop.elsevier.com/books/receptors-and-hormone-action/omalley/978-0-12-526302-3 Receptors and Hormone Action - 1st Edition | Elsevier Shop receptorshormoneactioneditionelsevier https://www.sciencedaily.com/releases/2005/12/051202132406.htm Overproducing Leptin Receptors In Fat Cells May Be Key To Halting Weight Gain | ScienceDaily A new study by researchers at UT Southwestern Medical Center suggests that when fat cells increase in size -- as they do during the development of obesity --... https://www.techtransfer.nih.gov/patent/e-105-2012-0-ie-23 Murine Anti-NY-ESO-1 T Cell Receptors | Technology Transfer t cell receptorsmurineantinyeso https://scholars.duke.edu/publication/678526 Scholars@Duke publication: Activation of EGF receptors mediates pulmonary vasoconstriction induced... scholarsdukepublicationactivation https://scholars.lib.ntu.edu.tw/entities/project/e6b89b3a-926a-4573-ba0f-0d0e4712a9b2 The Expression and Functional Analysis of Chemokine Receptors in Polymorphonuclear Neutrophils from... the expressionfunctional analysis https://experts.arizona.edu/en/publications/powdered-g-protein-coupled-receptors/fingerprints/ Powdered G-Protein-Coupled Receptors - Fingerprint - University of Arizona g proteinuniversity ofpowderedcoupledreceptors https://pubmed.ncbi.nlm.nih.gov/39531485/ Evolutionary history of calcium-sensing receptors unveils hyper/hypocalcemia-causing mutations Despite advancements in understanding the structure and functions of the Calcium Sensing Receptor (CaSR), gaps persist in our knowledge of the specific... evolutionary historycalciumsensing https://edrn.cancer.gov/data-and-resources/publications/10942134-341-transforming-growth-factor-beta-type-ii-receptors-and-smad-proteins-in-follicular-thyroid-tumors/ Transforming growth factor-beta type II receptors and smad proteins in follicular thyroid tumors. This is a publication by a member of the Early Detection Research Network. https://pmc.ncbi.nlm.nih.gov/articles/PMC11279859/ Safety Implications of Modulating Nuclear Receptors: A Comprehensive Analysis from Non-Clinical and... The unintended modulation of nuclear receptor (NR) activity by drugs can lead to toxicities amongst the endocrine, gastrointestinal, hepatic cardiovascular,... https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2024.1477991/full Frontiers | Germline natural killer cell receptors modulating the T cell response In addition to their central role during innate responses, NK cells regulate adaptive immunity through various mechanisms. A wide array of innate receptors h... natural killer cellfrontiersgermlinereceptorsresponse https://www.techtransfer.nih.gov/patent/e-230-2012-0-al-18 T Cell Receptors Recognizing MHC Class II-Restricted Mage-A3 | Technology Transfer t cell receptorsclass ii https://www.techtransfer.nih.gov/patent/e-025-2022-0-au-01 CD28 HINGE AND TRANSMEMBRANE CONTAINING CHIMERIC ANTIGEN RECEPTORS TARGETING GPC2 AND USE THEREOF |... https://neurocritic.blogspot.com/2007/10/joy-of-5-ht4-receptors.html The Neurocritic: The Joy of 5-HT4 Receptors the neurocriticjoyreceptors https://pmc.ncbi.nlm.nih.gov/articles/PMC7571062/ Quinoline-Based Molecules Targeting c-Met, EGF, and VEGF Receptors and the Proteins Involved in... The quinoline ring system has long been known as a versatile nucleus in the design and synthesis of biologically active compounds. Currently, more than one... https://www.mpg.de/7897435/ephrin-receptors-complexes Sociable receptors: in pairs, in groups or in a crowd | Max-Planck-Gesellschaft The proportion of different receptor groups in the cell membrane determines whether cell repulsion takes place. max plancksociablereceptorspairsgroups https://www.techtransfer.nih.gov/patent/e-230-2012-0-de-74 T Cell Receptors Recognizing MHC Class II-Restricted Mage-A3 | Technology Transfer t cell receptorsclass ii https://pmc.ncbi.nlm.nih.gov/articles/PMC51124/ Expressional potency of mRNAs encoding receptors and voltage-activated channels in the postmortem... The stability and integrity of mRNAs encoding neurotransmitter receptors and voltage-activated channels in the postmortem rat brain was investigated by... https://scholars.duke.edu/publication/787993 Scholars@Duke publication: Alpha-2 receptors mediate an endogenous noradrenergic suppression of... https://www.mdpi.com/1999-4923/14/2/329 The Natural Chemotherapeutic Capsaicin Activates AMPK through LKB1 Kinase and TRPV1 Receptors in... The natural bioactive compound capsaicin has been reported to have anticancer activity, although the underlying mechanism of action has not been completely... https://kuscholarworks.ku.edu/entities/publication/fde4e706-cff1-49e9-b253-57782d68a46a Evidence that 5-HT2A Receptors in the Hypothalamic Paraventricular Nucleus Mediate Neuroendocrine... The present study determined whether the serotonin2A (5-HT2A) receptors in the hypothalamic paraventricular nucleus mediate the neuroendocrine responses to a... in the https://www.wikidata.org/wiki/Q49167492 Two tumour necrosis factor receptors: structure and function. - Wikidata scientific article published in October 1995 twotumournecrosisfactorreceptors https://pure.psu.edu/en/publications/expression-of-adiponectin-and-its-receptors-is-altered-in-epithel/ Expression of adiponectin and its receptors is altered in epithelial ovarian tumors and... https://research.manchester.ac.uk/en/publications/changes-in-benzodiazepine-and-acetylcholine-receptors-in-the-glob/ Changes in benzodiazepine and acetylcholine receptors in the globus pallidus in Parkinson's... globus palliduschangesbenzodiazepineacetylcholine https://www.techtransfer.nih.gov/patent/e-135-2019-0-pct-02 T CELL RECEPTORS RECOGNIZING R175H OR Y220C MUTATION IN P53 | Technology Transfer t cell receptors https://pubmed.ncbi.nlm.nih.gov/34082070/ Differential expression of motilin receptors on the endothelium of dog gastrointestinal arteries... Motilin receptors are expressed differentially on the membranes of endothelial cells in dog gastrointestinal arteries with a significantly high expression in... differential expressionreceptors https://dl.tufts.edu/concern/pdfs/jq085x72s PDF | Trypanosoma cruzi co-opts myocardial neurotrophin receptors for invasion and cardiotrophism.... trypanosoma cruzi https://openresearch.surrey.ac.uk/esploro/outputs/conferencePresentation/A-Putative-Role-for-the-TGF/99513353502346 A Putative Role for the TGF beta Accessory Receptors Betaglycan and Endoglin in pulmonary... A Putative Role for the TGF beta Accessory Receptors Betaglycan and Endoglin in pulmonary Complications of Scleroderma. - University of Surrey - Conference... https://vivo.colorado.edu/display/pubid_223724 Evidence that cholecystokinin receptors are not involved in the hypothalamic-pituitary-adrenal... cholecystokinin receptorsare not https://pubchem.ncbi.nlm.nih.gov/bioassay/1914490 AID 1914490 - Selectivity interaction (MDS Pharma Service panel (GPCR, ion channels, receptors, and... BioAssay record AID 1914490 submitted by ChEMBL: Selectivity interaction (MDS Pharma Service panel (GPCR, ion channels, receptors, and other enzymes,... https://www.igf.cnrs.fr/en/psychedelics-antidepressant-effects-and-5-ht2a-receptors-2/ IGF - Psychedelics, antidepressant effects and 5-HT2A receptors Nov 5, 2024 - Antidepressant effects of psychedelics in a preclinical model of depression: is the 5-HT2A receptor the only player? igfpsychedelicsantidepressanteffectsreceptors