https://speakerdeck.com/amontalenti/streamparse-defeat-the-python-gil-with-apache-storm
PyCon 2015 talk on using streamparse to defeat the Python Global Interpreter Lock (GIL) via distributed computing atop Apache Storm.
apache stormdefeatpythongilspeaker
https://www.jackandjill.ie/events/apache-pizza-party-fundraiser/
May 19, 2025 - Good Food, Great Cause Bring your friends, family or work colleagues together for an Apache Pizza Party and make a big difference! It’s a fantastic way...
jack and jillapache pizzapartyfundraiserchildren
https://www.cloudera.com/blog/technical/unlocking-the-benefits-of-apache-impala.html
High-Performance SQL with Cloudera and Apache Impala
apache impalaunlockingbenefits
https://www.shapeblue.com/apache-cloudstack-certification/
Jul 11, 2025 - Validate your expertise in deploying and managing open-source cloud infrastructure with Apache CloudStack Certification Exam by ShapeBlue.
apachecertificationcloudstackcompany
https://sevimov.be/choosing-the-best-web-server-for-wordpress-nginx-vs-apache/
When it comes to choosing a web server for hosting a WordPress website, two of the most popular options are NGINX and Apache. Both servers have their own...
the bestweb serverchoosingwordpressnginx
https://thenewstack.io/the-new-look-and-feel-of-apache-kafka-4-0/
Mar 24, 2025 - Apache Kafka 4.0 significantly streamlines the platform by replacing ZooKeeper with KRaft for default metadata management.
the new lookapache kafkafeel
https://news.apache.org/foundation/entry/apache-trusted-releases-platform-begins-second-alpha
Nov 20, 2025 - By: Dave Fisher, Apache Software Foundation, VP Tooling The Apache Software Foundation (The ASF) established the VP, Tooling office last year tasked with...
the asfapachetrustedreleasesplatform
https://wpbuffs.com/apache-security-best-practices/
Aug 1, 2024 - Apache is an open source web server software that has been around since 1995 and is the leading web server software in the world with a 45.8% market share....
best practicesstepapachesecuritychecklist
https://www.redhat.com/ko/blog/celebrating-20-years-apache-software-foundation
]This past March, the Apache Software Foundation celebrated a significant milestone in its history: 20 years as a preeminent organization in the world of open...
apache software foundationcelebratingyears
https://mcpservers.com/servers/liuscraft-apache-superset
Bridges Apache Superset with TypeScript to enable direct interaction with data visualization dashboards, allowing querying, analysis, and visualization without...
model context protocolapache supersetaddmcpserver
https://www.gov.uk/government/news/apache-officer-named-young-woman-engineer-of-the-year
An officer who helped keep the British Army's Apache attack helicopters flying in the demanding environments of Afghanistan and Libya has been named Young...
young woman engineerthe yearapacheofficernamed
https://github.com/kubeflow/spark-operator
Kubernetes operator for managing the lifecycle of Apache Spark applications on Kubernetes. - GitHub - kubeflow/spark-operator: Kubernetes operator for managing...
githubkubeflowsparkoperatorkubernetes
https://originalfreenations.com/the-doctrine-of-christian-domination-the-apache-people-and-oak-flat/
Jul 1, 2023 - By Steven Newcomb (Shawnee/Lenape) The Apache Stronghold case, regarding the Apache Sacred Site (Chi’ Chil Bildagoteel) called “Oak Flat,” is now...
apache peopledoctrinechristiandominationoak
https://news.apache.org/foundation/entry/asf-project-spotlight-apache-geode
Nov 20, 2025 - Can you tell us a bit about the project?Apache Geode is an in-memory data grid that provides real-time, consistent access to data-intensive applications at...
the blogasfprojectspotlightapache
https://www.digitalocean.com/community/questions/how-do-i-configure-apache-to-run-my-app-when-a-browser-user-goes-to-the-domain-name-url
We have a CentOS7 Apache 2.4 droplet. Our java-based application is running fine, and can be accessed via a url similar to : http://my.subdomain.com...
how do iconfigureapacherunapp
https://aws.amazon.com/blogs/big-data/accelerate-query-performance-with-apache-iceberg-statistics-on-the-aws-glue-data-catalog/
August 2024: This post was updated with Amazon Athena support. Today, we are pleased to announce a new capability for the AWS Glue Data Catalog: generating...
apache icebergon theacceleratequeryperformance
https://www.theknot.com/marketplace/rehearsal-dinners-bridal-showers-apache-junction-az
Learn more about rehearsal dinner + bridal showers in Apache Junction on The Knot. Find, research and contact wedding professionals on The Knot, featuring...
rehearsal dinnerbridal showersapache junctionpricesaz
https://www.shapeblue.com/apache-cloudstack-integrations/
Jun 26, 2025 - Discover the supported Apache CloudStack integrations. Review the range of integrations that fit perfectly to your technology stack.
apache cloudstackthe companyintegrations
https://www.thetechnicaltalk.com/2025/03/apache-flink-architecture.html
apache flink tutorial, architecture, ecosystem, flink architecture and ecosystem
apache flinkarchitecturetechnicaltalk
https://thewest.com.au/news/wa/apache-fights-for-secrecy-on-varanus-gas-blast-ng-ya-316882
US energy giant Apache will make WA legal history by taking a Freedom of Information case related to the Varanus Island gas explosion to the Court of Appeal.
the westapachefightssecrecyvaranus
https://www.netapp.com/video/dke4bquslmw/apache-spark-40-the-future-of-big-data/
Explore the cutting-edge capabilities of Spark 4.0 and its potential to revolutionize the world of big data. Spark leverages Kubernetes and cloud...
the future ofapache sparkbig datanetapp
https://developer.confluent.io/learn-more/podcasts/chris-riccomini-on-the-history-of-apache-kafka-and-stream-processing/
Chris Riccomini tells us how Apache Kafka® and the stream processing framework Samza came about, and also what he’s doing these days at WePay—building...
on theapache kafkachrishistorystream
https://arizonarenfest.bigtickets.com/Hops2026/?referral=buypf,&
Big Tickets is the official ticket provider for Arizona Renaissance Festival presents The Hops! Arizona Renaissance Festival Pub Crawl at East of Apache...
arizona renaissance festivalpub crawlhopseastapache
https://www.infoq.com/news/2012/04/seam-deltaspike/
Seam 3.1 is the last "bundled" release from JBoss. The project continues in the form of Apache DeltaSpike (currently in incubation) an attempt to combine all...
the future ofjboss seamapacheinfoq
https://news.apache.org/foundation/entry/this-givingtuesday-help-the-apache-software-foundation-power-open-source-for-the-public-good
Nov 20, 2025 - On December 2, 2025, millions of people across more than 100 countries will come together for #GivingTuesday — a global movement celebrating generosity and...
apache software foundationopen sourcegivingtuesdayhelppower
https://www.kadeck.com/?b765d8e8_page=2
Transform your Apache Kafka infrastructure into an enterprise-grade platform with Kadeck Kafka UI for Apache Kafka. Ensure reliability & security, enforce...
the commandapache kafkadeck
https://www.theknot.com/marketplace/wedding-planners-apache-junction-az
Learn more about wedding planners in Apache Junction on The Knot. Find, research and contact wedding professionals on The Knot, featuring reviews and info on...
wedding plannersapache junctionthe knotpricesaz
https://hello.dremio.com/wp-apache-polaris-guide-reg.html
Accelerate AI and analytics with AI-ready data products - driven by unified data and autonomous performance.
apachepolarisdefinitiveguide
https://www.theknot.com/marketplace/wedding-photo-booth-rentals-apache-junction-az
Learn more about photo booth rentals in Apache Junction on The Knot. Find, research and contact wedding professionals on The Knot, featuring reviews and info...
photo boothapache junctionrentalspricesaz
https://cloudberry.apache.org/blog/apache-cloudberry-2025-review/
A year of milestones: First Apache release, growing community, and technical breakthroughs.
a yearin theapachecloudberryreview
https://pandio.com/sign-up/
Try Pandio for free! Sign up for the #1 distributed messaging service built on Apache Pulsar with zero risk and $50 in free usage!
sign upmanagedapachepulsarservice
https://news.apache.org/foundation/entry/celebrating-10000-committers-the-people-who-power-apache-software-projects
Dec 5, 2025 - By: Brian Proffitt, Vice President, Marketing & Publicity The Apache Software Foundation has come a long way since its founding in 1999, shepherding over...
the peopleapache softwarecelebratingcommitterspower
https://www.army.mil/article/77128/
The U.S. Army's AH-64 Apache Block III next-generation attack helicopter is finishing up its Initial Operational Test and Evaluation at Fort Irwin, Calif., and...
apacheblockiiihelicopterperforms
https://www.zigwheels.com/reviews-advice/reviews/2025-tvs-ymrp-round-2-finding-my-footing/56933/
Sep 14, 2025 - From practice struggles with a faulty gearbox to regaining lost confidence, here’s my TVS Young Media Racer Program Round 2 journey at MIC - qualifying 12th,...
riding thetvs apachertrracespec
https://www.developer-tech.com/resources/state-of-apache-airflow-report-the-latest-trends-around-data-pipeline-development-and-orchestration/
Oct 29, 2025 - Download the State of Apache Airflow Report. Discover the forefront of data orchestration and workflow management with the inaugural State of Apache Airflow...
apache airflowthe lateststatereporttrends
https://www.overdrive.in/reviews/2024-tvs-apache-rr310-track-review-the-updated-friendlier-flagship-model/
TVS have thrown in some interesting updates to its flagship fully-faired bike, the RR310, for 2024. Is it now the small-capacity performance machine that...
tvs apachetrackreviewfasterfriendlier
https://rockthejvm.com/courses/apache-spark-essentials-with-scala
Become an Apache Spark developer with our essentials course. Master the fundamentals of Apache Spark with Scala and big data through clear lessons, practical...
apache sparkessentialsscalarockjvm
https://www.indiatoday.in/auto/bikes/story/tvs-apache-rtx-crowned-indian-motorcycle-of-the-year-2026-2838156-2025-12-18
The TVS RTX has been crowned Indian Motorcycle of the Year 2026, emerging victorious in a fiercely contested field.
tvs apacheindian motorcyclethe yearrtxcrowned