https://www.usf.edu/arts-sciences/chronicles/2025/anthropology-professor-earns-national-recognition-for-contributions-to-field-of-biological-anthropology.aspx
University of South Florida
the fieldanthropologyprofessorearnsnational
https://news.xerox.co.uk/news/xerox-receives-hrh-the-prince-of-wales-terra-carta-seal-in-recognition-of-the-companys-commitment-to-creating-a-sustainable-future
Xerox Holdings Corporation has been awarded the inaugural 2021 Terra Carta Seal that recognizes global companies that are driving innovation and demonstrating...
the princexeroxreceiveshrhterra
https://www.sdcpromotions.com/writing-pens-click-pens.htm
The Recognition Group, Inc | Fair Oaks, CA. Best selection of promotional items, apparel and corporate gifts. Let us earn your business with our 1st class...
the recognitionpromotional productsfair oaksgroupinc
https://actonline.org/2021/02/03/about-face-the-year-in-facial-recognition-and-trends-to-watch-in-2021/
As with so many other fields, 2020 bore witness to a dizzying series of developments within the facial recognition policy sphere. At ACT| the App Association,...
about facethe yearfacial recognitiontrends
https://ester.co/blog/what-is-brand-storytelling
Jul 19, 2023 - What is brand storytelling and why it is important for your business? Read Ester Digital new article to learn everything about brand & visual storytelling.
what isthe darknessbrandstorytellinggain
https://www.aclu.org/news/privacy-technology/ice-face-recognition
Nov 13, 2025 - ICE and CBP are smashing their way not only through car windows but also through any constraints on the use of face recognition
face recognitionmade inmarriage
https://www.frontiersofknowledgeawards-fbbva.es/noticias/frontiers-knowledge-award-blanchard-gali-woodford-economics-17-edition/
Feb 27, 2025 - The BBVA Foundation Frontiers of Knowledge Awards in Economics, Finance and Management has gone in this seventeenth edition to Olivier Blanchard (Paris School...
knowledge awardfrontiersgoesblanchard
https://www.cnn.com/2019/10/17/tech/india-facial-recognition-intl-hnk
Oct 18, 2019 - India is setting up a countrywide facial recognition system, which will be one of the largest ones ever built. It will assist police forces, which are among...
india istrying tobiggest facialbuildrecognition
https://www.qub.ac.uk/sites/institute-for-global-peace-security-justice/news/2019/MitchellInstituteResearcherhaspublishedanarticleonfacialrecognition.html
A Visiting Researcher at the Mitchell Institute highlights some of the Human Rights concerns regarding facial recognition technology.
mitchell institutefacial recognitionresearcherpublishedarticle
https://www.rhd.org/meeting-moment-mcius-journey-compassion-recognition-new-orleans/
In the vibrant heart of New Orleans, where the community’s spirit runs as deep as its cultural roots, a dedicated team of mental health professionals has...
the momentmeetingjourneycompassion
https://www.gallup.com/workplace/236441/right-culture-not-employee-satisfaction.aspx?
Recognizing good work is a powerful, cost-effective method of improving organizational performance -- yet it is underused.
employee recognitionlow costhigh impactimportance
https://www.prdaily.com/how-the-houston-rodeo-expanded-its-national-brand-recognition/
Nov 25, 2025 - 3 steps to build a connection with the right sources. The Houston Livestock Show and Rodeo has long been a Texas staple, celebrated for its community impact...
houston rodeonational brandexpandedrecognitionpr
https://www.barsandcocktails.com.au/news/the-quality-of-australian-spirits-gains-global-recognition/
Oct 8, 2025 - The results of the 2025 International Wine & Spirits Competition have highlighted an Australian spirits industry that is in very good health.
qualityaustralianspiritsgainsglobal
https://www.thefloridastar.com/articles/facial-recognition-expands-in-airports-as-congress-eyes-new-limits/
Aug 23, 2025 - BLACKPRESSUSA NEWSWIRE — The system allows enrolled TSA PreCheck travelers with valid passports to verify their identity with a quick photo instead of a...
facial recognitionexpandsairportscongresseyes
https://www.mediapost.com/publications/article/301813/in-new-campaign-everlast-says-female-athletes-don.html
In New Campaign, Everlast Says Female Athletes Don't Get The Recognition They Deserve - 05/25/2017
female athletesnewcampaigneverlastsays
https://www.gov.scot/publications/scotland-act-1998-agency-arrangements-specification-recognition-qualifications-order-2025-child-rights-wellbeing-impact-assessment/
Child Rights and Wellbeing Impact Assessment (CRWIA) for UK ENIC service delivery in Scotland.
scotland actagencyarrangementsspecificationrecognition
https://simpleflying.com/uk-10-most-famous-airlines-busiest-routes/
Whether you choose an ultra-low-cost carrier or take an intercontinental flight in a private suite, these airlines have the busiest routes in the UK.
by frequencyroutesairlines
https://www.standardmedia.co.ke/article/2001417067/somaliland-still-struggling-for-recognition-61-years-after-independence
Somaliland enjoys peace, political stability and vibrant democracy for 30 yrs now in an area known for civil war, authoritarianism & political unrest.
somalilandstillstrugglingrecognitionyears
https://therecord.media/british-officials-seek-to-expand-facial-recognition-tech-use
Police have used facial recognition in Britain since 2017 and controversy has mounted as more aggressive deployments have been undertaken, including live...
facial recognition technologybritishofficialsseekexpand
https://linkiest.com/15-masterpiece-cartoons-that-never-got-the-recognition-they-deserved/
Nov 28, 2025 - The list is a combination of my personal opinions, as well other related lists on this topic that came before. I do use the previous lists to do my research...
the recognitionmasterpiececartoonsnevergot
https://thekunlunjingan.com/en/bookingprivilege2/loyaltyprogram/
The Kunlun Jing An is located in the heart of Shanghai. Easy access to Shanghai subway and relaxing rooms and suites with panoramic views of the city skyline.
recognition programloyaltyguestkunlunjing
https://www.the-independent.com/tech/meta-naga-munchetty-facebook-instagram-consumers-b2709192.html
Mar 5, 2025 - The social media giant first began rolling out the tools in October last year.
facial recognitionmetabringstoolsspot
https://debateus.org/the-african-union-should-grant-diplomatic-recognition-to-the-republic-of-somaliland-as-an-independent-state/
Podcast Discussion of the Essay Introduction Somaliland, a self-declared independent state in the Horn of Africa, has been seeking international recognition...
the african uniondiplomatic recognitiongrantrepublic
https://pubmed.ncbi.nlm.nih.gov/6657428/
A research programme has been carried out that concerns the accuracy with which listeners can identify a speaker heard once before. The present study examined...
the voicerecognitionaccuracyblindlisteners
https://pubmed.ncbi.nlm.nih.gov/30614835/
The results of this study confirm existing findings in the literature showing that older adults show significant deficits in voice emotion recognition compared...
of agehearing losson theeffectsrecognition
https://seed.hr/?ref=tokfluence
Seed is the only peer-to-peer recognition software that facilitates authentic and meaningful appreciation among your employees while planting trees for the...
doing goodseedhrbuildculture
https://www.allogram.com/
Allow Allogram to help you select the perfect plaque, trophy, acrylic, crystal or sign for any occasion. We will help you make the selection that works best...
the powerharnessrecognition
https://www.dataiq.global/recognition-dataiq-100/
recognition
https://www.newswire.ca/news-releases/netscout-receives-frost-amp-sullivan-s-2025-global-company-of-the-year-recognition-for-network-monitoring-leadership-804436646.html
/CNW/ -- Frost & Sullivan is pleased to announce that NETSCOUT has received the 2025 Global Company of the Year Recognition in the network monitoring...
global companynetscoutreceivesfrostamp
https://www.manilatimes.net/2025/11/29/business/science-technology/philippines-satellite-based-rice-monitoring-earns-global-recognition/2233323
IN a milestone that underscores the country’s strides in agricultural innovation, the Philippine Rice Information System (PRiSM) has garnered...
philippinessatellitebasedricemonitoring
https://www.newstatesman.com/spotlight/tech-regulation/cybersecurity/2022/07/facial-recognition-tech-biometric-data
The Southern Co-op faces a legal case over its use of surveillance technology to deter shoplifters.
facial recognitionin publicusetechspaces
https://reason.com/volokh/2022/02/02/the-false-narrative-about-bias-in-face-recognition/
The biggest beneficiaries of the narrative? Chinese and Russian technology firms
false narrativein facebiasrecognition
https://www.thenationalnews.com/world/lessons-in-covid-lockdown-resilience-routines-and-self-recognition-1.1172584
Special report: 'The National' spoke to people living through lockdowns across the world to hear how they stave off boredom, keep connected and adapt their...
covid lockdownlessonsresilienceroutinesself
https://pubmed.ncbi.nlm.nih.gov/23134684/
SH2 domains are long known prominent players in the field of phosphotyrosine recognition within signaling protein networks. However, over the years they have...
phosphotyrosinerecognitiondomainstypicalversatile
https://www.thedailyworld.com/news/grays-harbor-4-h-program-celebrate-our-kids-with-volunteer-recognition/
The Grays Harbor 4-H program held its annual Celebrate Our Kids 4-H event, which celebrated the past year’s achievements of its 4-H members and adult...
grays harborprogramcelebratekidsvolunteer
https://teenagepornx.com/puretaboo-arietta-adams-the-recognition-you-deserve-9/
Aug 23, 2024 - Claire (Arietta Adams) is surprised when her stepfather Gavin (Ryan Driller) comes home early from a gala where he was given an award. Not only is he home...
arietta adamsthe recognitionpuretaboodeserve
https://pubmed.ncbi.nlm.nih.gov/28811514/
The immunodominant staphylococcal antigen A (IsaA) is a potential target for active or passive immunization against the important human pathogen Staphylococcus...
in thedifferentialepitoperecognitionimmunodominant
https://www.thejakartapost.com/travel/2019/11/08/skip-the-queue-singapore-hotels-use-face-recognition-check-in.html
Skip the queue: Singapore hotels use face recognition check-in - News - The Jakarta Post
the queueface recognitioncheck inskipsingapore
https://hackernoon.com/testing-icp-face-recognition-dapp-the-final-result-will-surprise-you?source=rss
The ICP's unique infrastructure could assist us in performing complex tasks such as facial recognition without relying on centralized systems.
face recognitionthe finaltestingicpdapp
https://theramprules.com/pattern-recognition/
One of the biggest problems with statistical data actually comes from one of our greatest strengths: our pattern recognition ability.
pattern recognitionthe ramprules
https://thecyberguild.org/cyber-guild-recognition-awards/
Sep 16, 2025 - The annual Cyber Guild Recognition Awards recognizes individuals who believe that cybersecurity should be part of everyday living.
cyberguildrecognitionawards
https://bigthink.com/the-learning-curve/the-dark-side-of-workplace-recognition/
Recognition maintains relationships and promotes engagement, but our innate desire for it may nurture unhealthy work cultures.
the dark sideworkplacerecognition
https://deepai.org/publication/empirically-analyzing-the-effect-of-dataset-biases-on-deep-face-recognition-systems
12/05/17 - It is unknown what kind of biases modern in the wild face datasets have because of their lack of annotation. A direct consequence ...
the effectdeep faceempiricallyanalyzingdataset
https://www.openrightsgroup.org/events/org-glasgow-presents-facial-recognition-the-big-picture/
Following major developments across the UK and beyond, it’s more important than ever to understand facial recognition technology, an increasingly powerful...
the big picturefacial recognitionorgglasgowpresents
https://www.rrd.com/about/awards
Being recognized for our efforts in industry innovation, inclusion and corporate excellence is what makes RRD stand apart from the competition.
in theawardsrecognitioneffortsindustry
https://www.unr.edu/provost/faculty-affairs/recognition-and-awards
The Office of the Provost and Executive Vice President provides a range of awards, grants and recogition to faculty members from the University of Nevada,...
facultyrecognitionawardsgrantsaffairs
https://www.theregister.com/2020/10/26/in_brief_ai/
Plus: Facebook won't get lost in translation, Cruise all set to build fleet of driverless taxis, and more
the tablesturnedblokesaystrained
https://futurism.com/the-byte/lawsuit-claims-facial-recognition-ai-sent-wrong-man-jail
A man is suing NJ police after he was wrongfully arrested and imprisoned because of flawed, since-banned facial recognition AI.
the wrong manfacial recognitionlawsuitclaimssent
https://www.arxiv.org/abs/2402.04338
Abstract page for arXiv paper 2402.04338: Logical recognition method for solving the problem of identification in the Internet of Things
the problemlogicalrecognitionmethodsolving
https://rdipp.unimi.it/2023/02/24/the-italian-supreme-court-on-the-recognition-of-a-russian-judgment-in-italy/
Earlier this month (2 February 2023), the Italian Supreme Court (Corte di Cassazione) delivered its order No 3199/2023, rejecting an appeal against the Court...
the italiansupreme courtrecognitionrussian
https://www.therecognitionshop.com/floor-mats.htm
The Recognition Shop offers promotional items for all your business or personal needs. Our promotional items put your name and logo to work for you!
the recognitionshop floormats
https://www.gov.uk/guidance/ending-the-recognition-of-eu-certification-for-rail-interoperability-constituents-subsystems-and-entities-in-charge-of-maintenance-for-domestic-freig
Great Britain recognises EU declarations of conformity for the placing on the market of rail interoperability constituents.
recognitioneudeclarationsconformityplacing
https://eutoday.net/austrias-recognition-of-sharia-law-is-a-betrayal/
Aug 23, 2025 - Manfred Haimbuchner was even starker: “Sharia law is incompatible with the Austrian understanding of law and violates all moral standards.” His words may
sharia lawrecognitionbetrayal
https://arstechnica.com/gadgets/2025/04/hands-on-handwriting-recognition-app-brings-sticky-notes-into-the-21st-century/
Apr 10, 2025 - Rocketbook Reusable Sticky Notes are an excessive solution for too many sticky notes.
handwriting recognitionsticky noteshandsappbrings
https://carnegiecouncil.org/media/podcast/20191010-struggle-for-recognition-international-relations-michelle-murray
Oct 17, 2019 - How can established powers manage the peaceful rise of new great powers? Bard's Michelle Murray offers a new answer to this perennial question, arguing...
the struggleinternational relationsrecognitionmichellemurray
https://www.gallup.com/analytics/472658/workplace-recognition-research.aspx?utm_source=123&utm_medium=123&utm_term=Nurturing&utm_content=GoingGreen&utm_campaign=GoingGreen
Learn how a culture of recognition can transform the workplace.
in thegallupworkhumanrecognitionworkplace
https://www.nationalacademies.org/projects/ILAR-K-04-02-B
Recognition and Alleviation of Pain in Laboratory Animals aims to educate laboratory animal veterinarians; students, researchers and investigators;...
laboratory animalsrecognitionpainupdate
https://www.make-it-in-germany.com/en/visa-residence/types/recognition
The Federal Government's portal informs you about the visa for the recognition of professional qualification and qualification programmes of interest to...
the recognitionvisaforeignqualifications
https://www.accaglobal.com/russia/en/campaign/brexit/membership-regulations-brexit.html
The United Kingdom left the European Union on 31 January 2020 and entered a period of transition which ended on 31 December 2020. As a result, the eligibility...
brexit impacton therecognitioneeaprofessional
https://www.al-monitor.com/originals/2022/03/israel-uae-friendship-continues-mutual-recognition-driving-licenses
The agreement has been in the works since shortly after the signing of the Abraham Accords in 2020.
mutual recognitiondriving licensesisraeluaefriendship
https://www.puretaboo.com/en/photo/The-Recognition-You-Deserve/97620
View all porn pics from the scene The-Recognition-You-Deserve! Browse thousands of taboo sex pictures featuring the hottest pornstars from all over the world!
the recognitionpure taboodeservepics
https://www.gallup.com/workplace/236441/employee-engagement-drives-growth.aspx%E3%80%91
Recognizing good work is a powerful, cost-effective method of improving organizational performance -- yet it is underused.
employee recognitionlow costhigh impactimportance
https://www.royalmedcarecentre.com/understanding-stroke-prevention-recognition-and-the-path-to-recovery/
A stroke is a critical medical emergency characterized by a disruption in blood circulation to the brain. Its impact on global health is profound, as it
the pathunderstandingstrokepreventionrecognition