https://www.vetmed.auburn.edu/
Auburn University College of Veterinary Medicine
Auburn's biomedical scientists and veterinarians train with top faculty in a leading teaching hospital and cutting-edge research facilities.
auburn universitycollege ofveterinarymedicine
https://petdesk.com/
Veterinary Software Built to Reclaim Time and Connect With Clients
Veterinary software built to easily grow your clinic through communication tools, integrated phones, direct booking, AI-powered notes, and custom marketing.
veterinary softwareconnect withbuiltreclaimtime
https://www.vetsinengland.com/
England Vets – Find Local Veterinary Practices Across England
Find local vets and veterinary practices across England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesenglandvetsacross
https://www.petvetcarecenters.com/site/home
PetVet Care Centers | National Network of Veterinary Hospitals
With more than 420 general, specialty and emergency hospitals, PetVet Care Centers is a nationwide veterinary network with a solid commitment to pets and their...
care centersnational networkveterinaryhospitals
https://vidaveterinary.com/
Mobile Veterinarian in Austin, TX | Vida Veterinary Mobile Services
Compassionate mobile veterinary care in Austin, TX. House-call veterinary services including wellness exams, vaccinations, diagnostics, and hospice care.
mobile veterinarianaustin txvidaveterinaryservices
https://www.vetsinlondon.com/
Greater London Vets – Find Local Veterinary Practices in Greater London
Find local vets and veterinary practices in Greater London, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
greater londonfind localveterinary practicesvets
https://mjfveterinarycollege.org/
MJF College of Veterinary & Animal Sciences
college ofmjfveterinaryanimalsciences
https://www.vetsinireland.com/
Ireland Vets – Find Local Veterinary Practices Across Ireland
Find local vets and veterinary practices across Ireland. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesirelandvetsacross
https://suveto.com/
Supporting Veterinary Ownership | Suveto | Hospital Network
Jan 30, 2026 - At Suveto we empower and equip veterinarians and veterinary professionals to take ownership of their professional growth, personal well-being, and the future...
supportingveterinaryownershipsuvetohospital
https://www.veterinaryhouse.in/
Veterinary House
veterinaryhouse
https://www.pattersonvetrichmond.com/
Hannah Minch DVM | Richmond Veterinarians | Patterson Veterinary Hospital
We are a full service Veterinary Hospital offering everything in one place from exams and vaccinations to surgery, grooming and boarding for all types of pets
hannahdvmrichmondveterinarianspatterson
https://www.acvetclinic.org/
Ark City Vet Clinic – Quality Veterinary care for 40+ years.
quality veterinary careark cityclinic
https://veterinarypartner.vin.com/
Veterinary Partner - VIN
veterinary partnervin
https://www.pawsandperches.com/services-2/
Veterinary Services in Lake Wales, FL | Paws and Perches Animal Hospital
lake wales flveterinary services
https://www.vetsinnorthernireland.com/
Northern Ireland Vets – Find Local Veterinary Practices Across Northern Ireland
Find local vets and veterinary practices across Northern Ireland. Browse trusted clinics, emergency care and specialist treatments for your pets.
northern irelandfind localveterinary practicesvetsacross
https://vetcelerator.com/
Veterinary Marketing Agency and Membership GPO | Vetcelerator
Jul 8, 2026 - Join Vetcelerator to gain the advantage of a GPO and veterinary marketing agency in one, giving your clinic stronger marketing and better cost savings.
veterinary marketingagencymembershipgpovetcelerator
https://vci.admissions.nic.in/
Veterinary Council of India Admission and eCounselling Service | India
of indiaveterinarycounciladmissionservice
https://veterinarybehaviorclinic.com/
Veterinary Behavior Clinic Domain: veterinarybehaviorclinic.com
Discover veterinarybehaviorclinic.com, a .com domain fitting veterinary clinics.
veterinarybehaviorclinicdomain
https://websyvet.com/
Veterinary Website Design & Marketing | Websy Vet
veterinary website designmarketingwebsy
https://www.ethosdiscovery.org/
Non-Profit Veterinary Science Research & Clinical Trials | Ethos Discovery
Jun 26, 2026 - Ethos Discovery, a nonprofit organization dedicated to veterinary science research, collaborates with Ethos Veterinary Health to conduct clinical trials for...
non profitveterinary scienceclinical trialsresearchethos
https://www.vetsinwestmidlands.com/
West Midlands Vets – Find Local Veterinary Practices in West Midlands
Find local vets and veterinary practices in West Midlands, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
west midlandsfind localveterinary practicesvets
https://www.localveterinaryhealth.com/
Local Veterinary Care Near Me in South Carolina, Local Veterinary
veterinary carenear melocalsouthcarolina
https://allvetnearme.com/
🐶 All Vet Near Me ⚡️ Find your Veterinary Center 2026 ✔️
May 25, 2022 - ➤ With ALL VET NEAR ME you can find veterinary clinic in Town. ☎ We have all phone numbers and addresses. ⌚ The Largest List of Veterinary Hospitals in the U.S.
all vet near me
https://www.ethosvet.com/
Ethos Veterinary Hospital Network | Specialty and Emergency Services
Jun 22, 2026 - Ethos Veterinary Health is a national network of veterinary hospitals providing specialty and emergency care for pets. Find a hospital near you!
veterinary hospitalethosnetworkspecialtyemergency
https://www.antrimvets.com/
Antrim Vets – Find Local Veterinary Practices in Antrim
Find local vets and veterinary practices in Antrim, Northern Ireland. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesantrimvets
https://www.vetsinwales.com/
Wales Vets – Find Local Veterinary Practices Across Wales
Find local vets and veterinary practices across Wales. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practiceswalesvetsacross
https://www.vetstrategy.com/
VetStrategy | Canada's Leading Veterinary Network
Jun 9, 2025 - We're a leading Canadian veterinary provider and network of clinics and hospitals, dedicated to healthy animals, happy pets, and satisfied owners.
canadaleadingveterinarynetwork
https://cheshirepartnersllc.com/
Veterinary Websites, SEO and GEO for Veterinarians
May 13, 2026 - Cheshire Partners will transform your veterinary practice with expert website design, SEO, GEO and digital marketing to attract pet owners and drive growth.
seo and geoveterinary websitesveterinarians
https://vetpay.com.au/
VetPay | Keeping Veterinary Care Affordable
Mar 19, 2026 - VetPay offers a simple payment solution for all your pets Veterinary needs. Apply now in under 5 minutes. Approval in 15 minutes.
veterinary carevetpaykeepingaffordable
https://wsava.org/
WSAVA | World Small Animal Veterinary Association
Jan 27, 2026 - WSAVA is a global community of more than 200,000 veterinarians worldwide working to advance the health and welfare of companion animals throughout the world.
small animalwsavaworldveterinaryassociation
https://www.westyorkshirevets.com/
West Yorkshire Vets – Find Local Veterinary Practices in West Yorkshire
Find local vets and veterinary practices in West Yorkshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
west yorkshirefind localveterinary practicesvets
https://www.southyorkshirevets.com/
South Yorkshire Vets – Find Local Veterinary Practices in South Yorkshire
Find local vets and veterinary practices in South Yorkshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
south yorkshirefind localveterinary practicesvets
https://www.canadianveterinarians.net/
Canadian Veterinary Medical Association | CVMA
The CVMA is the national voice for Canada's veterinarians, advocating for animal welfare, professional standards, and providing essential resources and...
veterinary medicalcanadianassociationcvma
https://svmg.com.au/
Veterinary Marketing Agency Australia | SVMG
Jun 11, 2026 - Grow your veterinary practice with SVMG’s specialised veterinary marketing services. From website design and SEO to Google Ads and social media marketing.
veterinary marketingagencyaustralia
https://wsava-congress.org/
WSAVA 2026 | 51st World Small Animal Veterinary Association Congress
Jul 9, 2026 - Join us at the 51th World Small Animal Veterinary Association Congress (WSAVA 2026), which will take place from 13-15 October 2026, in Warsaw, Poland.
small animalwsavaworldveterinaryassociation
https://graylyncrestanimal.com/
Best Veterinary Hospital in Wilmington, DE | Graylyn Crest Animal Hospital
Jul 24, 2025 - We’re here to keep your animal family happy and healthy! Whether you have a dog, cat, bird, or snake, learn how we go above and beyond.
veterinary hospitalwilmington debestcrestanimal
https://www.ovma.org/
Ontario Veterinary Medical Association - Home
veterinary medicalontarioassociation
https://hvspca.org/
hvspca.org: Humanitarian Veterinary Support
Discover hvspca.org, a premium .org domain for animal welfare organizations, offering a strong online presence.
humanitarianveterinarysupport
https://centrevilleveterinary.com/
Best Vet In Wilmington, DE 19807 | Centreville Veterinary Hospital
Apr 27, 2026 - We’re here to keep your animal family happy and healthy! Whether you have a dog, cat, bird, or snake, learn how we go above and beyond.
in wilmingtonbestvetdecentreville
https://www.hampshirevets.com/
Hampshire Vets – Find Local Veterinary Practices in Hampshire
Find local vets and veterinary practices in Hampshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practiceshampshirevets
https://www.vetsessex.com/
Essex Vets – Find Local Veterinary Practices in Essex
Find local vets and veterinary practices in Essex, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesessexvets
https://www.ivsa.org/
International Veterinary Students Association
international veterinarystudentsassociation
https://statvet.com/
Best Veterinary Hospital In Tulsa, OK | STATVet Animal Urgent Care
May 4, 2026 - STATVet is Tulsa’s dedicated veterinary urgent care, treating most illnesses, injuries, and minor emergencies in dogs and cats.
veterinary hospitaltulsa okbestanimalurgent
https://www.nashvillevetspecialists.com/
24 Hour Emergency Vet Hospital | Nashville Veterinary Specialists
Nashville Veterinary Specialists provides emergency and specialty care for pets across Nashville and Davidson County, TN. Referrals welcome - Call today.
emergency vethourhospitalnashvilleveterinary
https://www.vetsinwestsussex.com/
West Sussex Vets – Find Local Veterinary Practices in West Sussex
Find local vets and veterinary practices in West Sussex, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
west sussexfind localveterinary practicesvets
https://tapir.vet/
Veterinary Marketing Agency for Practices | Tapir
Apr 22, 2026 - Tapir helps veterinary practices grow with custom websites, SEO, content, and more. Marketing that works, made by a team who gets the vet world.
veterinary marketingfor practicesagencytapir
https://talleyvilleveterinary.com/
Best Veterinary Hospital In Wilmington, DE
Dec 10, 2024 - We’re here to keep your animal family happy and healthy! Whether you have a dog, cat, bird, or snake, learn how we go above and beyond.
veterinary hospitalbestwilmingtonde
https://www.tyneandwearvets.com/
Tyne and Wear Vets – Find Local Veterinary Practices in Tyne and Wear
Find local vets and veterinary practices in Tyne and Wear, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
tyne and wearfind localveterinary practicesvets
https://www.molonglovet.com.au/
Molonglo Veterinary Clinic
molongloveterinaryclinic
https://myvet.mu/
Veterinary Clinic in Mauritius - MYVET
veterinary clinicmauritius
https://www.glamorganvets.com/
Glamorgan Vets – Find Local Veterinary Practices in Glamorgan
Find local vets and veterinary practices in Glamorgan, Wales. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesglamorganvets
https://psmjournals.org/index.php/vetres
PSM Veterinary Research
PSM Veterinary Research (ISSN: 2518-2714) is a peer-reviewed, open access, multidisciplinary, international journal that publishes research on all aspects of...
psmveterinaryresearch
https://www.berkshirevets.com/
Berkshire Vets – Find Local Veterinary Practices in Berkshire
Find local vets and veterinary practices in Berkshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesberkshirevets
https://windcrestanimalcorporate.com/wilmington-de-veterinary-employment/
Wilmington, DE Veterinary Employment - Windcrest Animal Hospital Group
Sep 17, 2024 - Thank you for considering Windcrest Animal Hospital as your choice for employment. Please fill out the job application as accurately as possible.
wilmington deanimal hospitalveterinaryemploymentwindcrest
https://www.scholfieldveterinary.com/
SCHOLFIELD VETERINARY HOSPITAL, PLC - Home
New patients welcome at Scholfield Veterinary Hospital of Kentwood, MI. Complete Medical And Surgical Care, Pet Check-Ups, And More. Call our office at...
veterinary hospitalplc
https://www.vetsinmanchester.com/whitefield-best-vets-reviews
Vets in Whitefield | Greater Manchester Veterinary Clinics & 24-Hour Care | Updated January 2026
Find local vets, animal hospitals, and out-of-hours care in Whitefield, Greater Manchester. Compare services, opening times, reviews, and emergency vets open...
https://www.pattersonvet.com/
Veterinary Supplies, Equipment & Services | Patterson
View a complete range of vet supplies and products, equipment, software, digital technology and services for veterinary clinics.
veterinary suppliesequipment servicespatterson
https://www.vetsinscotland.com/
Scotland Vets – Find Local Veterinary Practices Across Scotland
Find local vets and veterinary practices across Scotland. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesscotlandvetsacross
https://www.valleyvetemergency.com.au/
Valley Veterinary Emergency weekend clinic for Canberra and surrounds
Emergency vet services for cats and dogs, addressing urgent medical needs for pets in Canberra, ACT, and surrounding areas. Exotic pets are case-dependent -...
veterinary emergencyvalleyweekendcliniccanberra
https://www.cambridgeshirevets.com/
Cambridgeshire Vets – Find Local Veterinary Practices in Cambridgeshire
Find local vets and veterinary practices in Cambridgeshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicescambridgeshirevets
https://www.acvs.org/
American College of Veterinary Surgeons
Jul 7, 2026 - The American College of Veterinary Surgeons is the agency by which veterinarians are certified as specialists in surgery. The mission of ACVS is to advance the...
american collegeveterinarysurgeons
https://www.merseysidevets.com/
Merseyside Vets – Find Local Veterinary Practices in Merseyside
Find local vets and veterinary practices in Merseyside, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesmerseysidevets
https://www.practicemadepurrfect.com/
Veterinary Practice Business Consultant | Practice Made Purrfect
Vet practice marketing and business solutions. We grow practices through improving pet health plans, increasing client numbers and improving pet owner...
veterinary practicebusiness consultantmadepurrfect
https://www.lancashirevets.com/
Lancashire Vets – Find Local Veterinary Practices in Lancashire
Find local vets and veterinary practices in Lancashire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practiceslancashirevets
https://cvma.net/
California Veterinary Medical Association (CVMA)
Jul 15, 2026 - California Veterinary Medical Association (CVMA) advocates for veterinary professionals, animal welfare, advancing care, CE, and resources.
veterinary medicalcaliforniaassociationcvma
https://www.somersetvets.com/
Somerset Vets – Find Local Veterinary Practices in Somerset
Find local vets and veterinary practices in Somerset, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicessomersetvets
https://www.vetsindublin.com/
Dublin Vets – Find Local Veterinary Practices in Dublin
Find local vets and veterinary practices in Dublin, Ireland. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesdublinvets
https://www.sconeequinehospital.com.au/
Equine Veterinary Services NSW: Scone Equine Hospital
Sep 5, 2025 - Scone Equine Hospital in NSW is Australia’s largest provider of equine veterinary services. Call today for full-service horse care in the upper Hunter Valley.
equine veterinary servicesnswsconehospital
https://www.eastyorkshirevets.com/
East Yorkshire Vets – Find Local Veterinary Practices in East Yorkshire
Find local vets and veterinary practices in East Yorkshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
east yorkshirefind localveterinary practicesvets
https://vscsarasota.com/
Veterinary Surgery Center of Sarasota FL - Certified Vet Specialist / Surgeon - Animal & Pet Care...
https://www.wiltshirevets.com/
Wiltshire Vets – Find Local Veterinary Practices in Wiltshire
Find local vets and veterinary practices in Wiltshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practiceswiltshirevets
https://www.bva.co.uk/
BVA - British Veterinary Association
BVA represents, supports and champions over 19,000 members of all ages, stages and disciplines
bvabritishveterinaryassociation
https://www.veterinarydentalforum.org/
Veterinary Dental Forum®
veterinarydental
https://www.lajollavet.com/
Veterinarian in La Jolla | La Jolla Veterinary Hospital
At La Jolla Veterinary Hospital, we assist with all of the pet care needs of the La Jolla, CA community. Call (858) 454-6155 to schedule a pet exam today!
in laveterinarianjollaveterinaryhospital
https://arshinevet.com/
Efficient & Professional Supplier of Veterinary APIs
Arshine Lifescience is dedicated to supplying APIs for the prevention, treatment and care of diseases in chickens, pigs, cattle, sheep, aquatic animals and...
efficientprofessionalsupplierveterinaryapis
https://www.townandcountrysd.com/
Veterinary in Bonita | Town And Country Animal Hospital
town and countryveterinarybonitaanimalhospital
https://royalpetsclinic.com/
royalpetsclinic.com – Royal Pets Veterinary Clinic, situated in the heart of Garhoud Dubai, stands...
https://www.scvma.org/
SCVMA | Southern California Veterinary Medical Association
The SCVMA is the nations largest regional veterinary medical association representing over 700 hospitals and 1200 members. We consider ourselves to be the...
southern californiaveterinary medicalassociation
https://www.acvoconference.org/
ACVO 2026 Conference American College Veterinary Ophthalmologists Conference
American College of Veterinary Ophthalmologists, ACVO, is the premier provider of veterinary ophthalmology education in the world. The conference provides...
american collegeconferenceveterinaryophthalmologists
https://www.tribecavets.com/
Veterinary Care in New York, NY | Tribeca Soho Animal Hospital
Tribeca Soho Animal Hospital has proudly been the premier family and emergency veterinarian for the pets and pet owners of the New York community since 1982.
in new yorkveterinary carenytribecasoho
https://www.westvillagevets.com/
Veterinarian | West Village Veterinary Hospital
West Village Veterinary Hospital has proudly been serving pets and pet owners in New York with superior veterinary care since 1979. Come see us today!
west villageveterinarianveterinaryhospital
https://www.gloucestershirevets.com/
Gloucestershire Vets – Find Local Veterinary Practices in Gloucestershire
Find local vets and veterinary practices in Gloucestershire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesgloucestershirevets
https://tamworthequine.com.au/
Full-Service Horse Hospital: Tamworth Equine Veterinary Centre
Nov 15, 2021 - Tamworth Equine Veterinary Centre offers expert and dedicated equine veterinary services in NSW. Call today for dedicated, expert horse care.
full servicehorsehospitaltamworthequine
https://www.navp.co.uk/
NAVP | National Association of Veterinary Physiotherapists
Jun 18, 2026 - View NAVPs' Homepage page here.
national associationnavpveterinaryphysiotherapists
https://www.vetsinkent.com/
Kent Vets – Find Local Veterinary Practices in Kent
Find local vets and veterinary practices in Kent, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practiceskentvets
https://www.devonvets.com/
Devon Vets – Find Local Veterinary Practices in Devon
Find local vets and veterinary practices in Devon, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesdevonvets
https://www.vetsinstaffordshire.com/
Staffordshire Vets – Find Local Veterinary Practices in Staffordshire
Find local vets and veterinary practices in Staffordshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
staffordshire vetsfind localveterinary practices
https://www.shropshirevets.com/
Shropshire Vets – Find Local Veterinary Practices in Shropshire
Find local vets and veterinary practices in Shropshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesshropshirevets
https://www.bedfordshirevets.com/
Bedfordshire Vets – Find Local Veterinary Practices in Bedfordshire
Find local vets and veterinary practices in Bedfordshire, England. Browse trusted clinics, emergency care and specialist treatments for your pets.
find localveterinary practicesbedfordshirevets
https://www.svme.org/
Society For Veterinary Medical Ethics - Home
Society for Veterinary Medical Ethics was formed to encourage debate about ethical issues in veterinary practice management.
for veterinarymedical ethicssociety
https://www.vetsinashford.com/
Vets in Ashford | Kent Veterinary Directory | Updated January 2026
Jul 21, 2026 - Find trusted veterinary clinics in Ashford, Kent, England. Compare services, opening hours, emergency care and reviews from local pet owners.
vetsashfordkentveterinarydirectory
https://www.vetinternational.eu/
Vet international – Events in the veterinary sector
vet internationaleventsveterinarysector
https://www.southamptonvets.com/
Vets in Southampton | Hampshire Veterinary Directory | Updated January 2026
Jul 18, 2026 - Find trusted veterinary clinics in Southampton, Hampshire, England. Compare services, opening hours, emergency care and reviews from local pet owners.
vetssouthamptonhampshireveterinarydirectory
https://www.securos.com/
Securos Surgical | Veterinary Orthopedics, Surgical Instruments, and Sutures
For over 20 years, we’ve designed quality surgical products and services to help you provide animals with the best possible care. For orthopedic implants,...
securos surgicalveterinary orthopedicsinstrumentssutures
https://www.eurekavet.com.au/
Professional and Compassionate Veterinary Care by Eureka Veterinary Hospital Ballarat
At the Eureka Veterinary Group, our team have the skills and equipment to provide you and your pet with the professional and compassionate veterinary care you...
veterinary careprofessionalcompassionateeurekahospital
https://www.northdublinvets.com/
Vets in North Dublin City | Dublin Veterinary Directory | Updated January 2026
Jul 19, 2026 - Find trusted veterinary clinics in North Dublin City, Dublin, Ireland. Compare services, opening hours, emergency care and reviews from local pet owners.
north dublinvetscityveterinarydirectory
https://www.solihullvets.com/
Vets in Solihull | West Midlands Veterinary Directory | Updated January 2026
Jul 19, 2026 - Find trusted veterinary clinics in Solihull, West Midlands, England. Compare services, opening hours, emergency care and reviews from local pet owners.
west midlandsvetssolihullveterinarydirectory
https://www.harrowvets.com/
Vets in Harrow | Greater London Veterinary Directory | Updated January 2026
Jul 18, 2026 - Find trusted veterinary clinics in Harrow, Greater London, England. Compare services, opening hours, emergency care and reviews from local pet owners.
greater londonvetsharrowveterinarydirectory
https://www.merckvetmanual.com/
Merck Veterinary Manual
The Merck Veterinary Manual has been a trusted source of animal health information for students and practicing veterinarians. It contains authoritative...
merckveterinarymanual
https://www.ysenmedveterinary.com/
Veterinary Equipment Supplier,Wholesale Veterinary Supplies-ysenmedveterinary
Veterinary Equipment Supplier,Wholesale Veterinary Supplies-ysenmedveterinary
veterinary equipmentsupplies