Robuta

https://www.coloradogives.org/organization/WDRC White Dwarf Research Corporation | ColoradoGives.org We conduct basic scientific research using NASA space telescopes, ground-based observatories, and national super-computing facilities. We also engage in... white dwarfresearchcorporation https://grognardia.blogspot.com/2021/12/white-dwarf-issue-21.html?m=1 GROGNARDIA: White Dwarf: Issue #21 Issue #21 of White Dwarf (October/November 1980) begins with an editorial by Ian Livingstone in which he opines about magic systems in fant... white dwarfgrognardiaissue https://natfka.blogspot.com/2012/09/horus-heresy-pics-from-oct-white-dwarf.html?m=0 Horus Heresy Pics from Oct White Dwarf - Faeit 212 There are more pics circulating now, and these are the latest from over at Dice and Brush. It shows us the first Primarch Angron in all h... horus heresywhite dwarfpicsoct https://www.space.com/partial-supernova-white-dwarf-blasts-across-milky-way.html 'Partial supernova' blasts white dwarf star across the Milky Way | Space Jul 15, 2020 - A strange white dwarf star hurtling through the Milky Way may be the survivor of a "partial supernova," a new study finds. the milky waywhite dwarfpartialsupernovablasts https://tomsche69.blogspot.com/2017/04/review-white-dwarf-april-2017.html An Old Belgian Otaku: Review: White Dwarf April 2017 My geeky adventures in the wonderful world of anime and wargaming, and things that catch my fancy ;-) white dwarfoldbelgianotakureview https://meetings-archive.aps.org/dpp/2019/po9/11/ The White Dwarf Photosphere Experiment - Student Day (2:00pm - 6:00pm) the whitestudent daydwarfphotosphereexperiment https://natfka.blogspot.com/2011/09/october-white-dwarf-new-scrolls-of.html October White Dwarf: New Scrolls of Binding - Faeit 212 There are 3 new (Storm of Magic) scrolls of binding in the latest edition of White Dwarf that are for the Thundertusk, Stonehorn and... white dwarfoctobernewscrollsbinding https://science.nasa.gov/asset/hubble/white-dwarf-merger-illustration/ White Dwarf Merger Illustration - NASA Science Aug 17, 2025 - An illustration of a white dwarf star merging with a red giant star. A bow shock forms as the dwarf plunges through the star's outer atmosphere. white dwarfmergerillustrationnasascience https://grognardia.blogspot.com/2022/08/white-dwarf-issue-46.html GROGNARDIA: White Dwarf: Issue #46 Issue #46 of White Dwarf (October 1983), with its striking cover by Gary Mayes, is one I owned but about which I have few strong memories. ... white dwarfgrognardiaissue https://arxiv.org/abs/2504.07919 [2504.07919] Double White Dwarf Tides with Multi-messenger Measurements Abstract page for arXiv paper 2504.07919: Double White Dwarf Tides with Multi-messenger Measurements white dwarfmulti messengerdoubletidesmeasurements https://natfka.blogspot.com/2012/09/white-dwarf-what-is-happening-on-22nd.html?m=0 White Dwarf: What is Happening on the 22nd!!!! - Faeit 212 White Dwarf is getting a new launch on September 22nd. Its is going to be a big release, and some rumors have it that the next release ... what is happeningwhite dwarfon the https://drive.google.com/file/d/1r9HWME4ymlMh7SPDJGPBXwnJhMcGYLOf/view?usp=sharing The_25_Brightest_White_Dwarf_Stars.pdf - Google Drive white dwarfbrighteststarspdfgoogle https://natfka.blogspot.com/2019/07/kill-team-chaos-daemons-rules-from.html?m=0 Kill Team: Chaos Daemons Rules from White Dwarf - Faeit 212 I just saw these floating around.... the new White Dwarf is coming up for orders right now and will ship on the 16th. kill teamchaos daemonswhite dwarfrules https://apocalypse40k.blogspot.com/2014/01/warhammer-visions-white-dwarf-video.html?showComment=1391160613076 Heresy30K - The Horus Heresy Blog: Warhammer Visions / White Dwarf Video Review A video review of the new White Dwarf and Warhammer Visions. the horus heresywarhammer visionswhite dwarfblog https://jasonzavoda-hallofthemountainking.blogspot.com/2016/04/white-dwarf-9-cover-art.html?m=0 Hall of the Mountain King: White Dwarf #9 Cover Art Cover Art By Christopher Perigo Meh... Couple o'dead green scaly guys, stupid looking crossbow gun, guy riding big chicken... I like ... hall of the mountain kingwhite dwarfcoverart https://tobias-lib.uni-tuebingen.de/xmlui/handle/10900/143165 A helium-burning white dwarf binary as a supersoft X-ray source white dwarfx rayheliumburning https://par.nsf.gov/biblio/10473907-all-sky-faint-da-white-dwarf-spectrophotometric-standards-astrophysical-observatories-complete-sample All-sky Faint DA White Dwarf Spectrophotometric Standards for Astrophysical Observatories: The... This page contains metadata information for the record with PAR ID 10473907 all skywhite dwarf https://jasonzavoda-hallofthemountainking.blogspot.com/2016/04/white-dwarf-12-fiend-factory.html Hall of the Mountain King: White Dwarf #12 The Fiend Factory These are some of my favorite monsters from the Fiend Factory. I like the comments which tend to catch some of the flaws in the write-ups... hall of the mountain kingwhite dwarffiendfactory https://natfka.blogspot.com/2015/05/combined-admech-next-weeks-exclusive.html Combined Admech!- Next Week's Exclusive White Dwarf Formation - Faeit 212 Next week's White Dwarf hints mentioned an exclusive formation coming, and this rumor declares it to be a combined Adeptus Mechanicus fo... next weekwhite dwarfcombinedadmech https://forums.tomshardware.com/threads/review-white-dwarf-302.156571/ Review - White Dwarf 302 | Tom's Hardware Forum white dwarfreviewtomhardwareforum https://eprints.soton.ac.uk/453311/ An accreting white dwarf displaying fast transitional mode switching - ePrints Soton white dwarfdisplaying https://researchportalplus.anu.edu.au/en/publications/the-empirical-white-dwarf-cooling-sequence/ The empirical white dwarf cooling sequence - The Australian National University white dwarfempiricalcoolingsequenceaustralian https://wargamestuff.blogspot.com/2011/06/white-dwarf-retrospective-121-january.html Wargames & Stuff: White Dwarf Retrospective - 121 January 1990 Today's post heralds the start of a new semi-regular feature (I hope). As I have mentioned a few times before, my Chaos Warband building ha... white dwarfwargamesstuffretrospectivejanuary https://natfka.blogspot.com/2012/07/daemon-images-from-white-dwarf.html Daemon Video Reveal from White Dwarf + Images - Faeit 212 Edit: Go here to see a video of the August White Dwarf http://natfka.blogspot.com/2012/07/look-at-new-white-dwarf-and-munitorum.html ... white dwarfdaemonvideorevealimages https://arxiv.org/abs/2202.03895 [2202.03895] Searching for white dwarf variables in TESS data Abstract page for arXiv paper 2202.03895: Searching for white dwarf variables in TESS data searching forwhite dwarfvariablestessdata https://grognardia.blogspot.com/2021/10/white-dwarf-issue-14.html?m=0 GROGNARDIA: White Dwarf: Issue #14 Issue #14 of White Dwarf (August/September 1979) sports an unusual cover by Emmanuel, best known for the iconic cover of the Fiend Folio . ... white dwarfgrognardiaissue https://jasonzavoda-hallofthemountainking.blogspot.com/2016/04/white-dwarf-8-molten-magic.html Hall of the Mountain King: White Dwarf #8 - Molten Magic Molten Magic covers a wide range of miniatures from a truly horrendous 'Stubborn Krot' produced by Heritage Models to some decent looking... hall of the mountain kingwhite dwarfmoltenmagic https://natfka.blogspot.com/2021/12/white-dwarf-tyranid-leaks-flashpoint.html White Dwarf Tyranid Rules Leaked- Flashpoint Octarius - Faeit 212 Issue 471 will contain some more Tyranid rules in a new Flashpoint Octarius. Someone has them a little a early. Lets take a look white dwarftyranidrulesleakedflashpoint https://carlkop.home.xs4all.nl/whitegam.html Gamma-ray flares on white dwarf star gamma rayon whiteflaresdwarfstar https://www.cfht.hawaii.edu/en/news/WhiteDwarfFields/ White Dwarf Magnetic Fields Welcome to the Canada France Hawaii Telescope Website white dwarfmagneticfields https://science.nasa.gov/asset/hubble/ancient-white-dwarf-stars-in-the-milky-way-galaxy/ Ancient, White Dwarf Stars in the Milky Way Galaxy - NASA Science the milky way galaxyancient whitestars indwarf https://science.nasa.gov/missions/hubble/nasas-hubble-uncovers-rare-white-dwarf-merger-remnant/ NASA's Hubble Uncovers Rare White Dwarf Merger Remnant - NASA Science Aug 13, 2025 - Hubble's uncovers ultra-massive white dwarf star formed from a merger with another star. They may be more common than previously suspected.. rare whitenasahubbledwarfmerger https://natfka.blogspot.com/2014/01/what-weekly-releases-white-dwarf-with.html Weekly Releases, White Dwarf With Rules - Faeit 212 The changes are here, and already we are getting some of the details that include White Dwarf being confirmed to start having rules in th... weekly releaseswhite dwarfrules https://science.nasa.gov/asset/webb/spectrum-of-a-blue-giant-vs-spectrum-of-a-white-dwarf/ Spectrum of a Blue Giant vs. Spectrum of a White Dwarf - NASA Science Aug 28, 2025 - Differences in the width and clarity of absorption lines of stars can indicate differences in density. The absorption lines of a white dwarf are much broader... of ablue giantwhite dwarfspectrumvs https://natfka.blogspot.com/2012/09/white-dwarf-daily-announced-and-some.html?m=0 White Dwarf Daily Announced!!!!! and some Inside Information - Faeit 212 First off, This is big news. Second, I have been working on this story for about 2 days now, and had the announcement date wrong..... I... white dwarfinside informationdailyannounced https://anythingbutones.blogspot.com/2010/10/new-november-white-dwarf-is-here.html Anything But Ones: New november white dwarf is here! Sure feels good to open up your letterbox to find the latest issue! This issue as expected is jam packed with lovely dark elder pictures. Lo... white dwarfanythingonesnewnovember https://publikationen.uni-tuebingen.de/xmlui/handle/10900/48716 Diffusion processes in white dwarf stellar atmospheres in whitediffusionprocessesdwarfstellar https://mrsaturdaysmumblings.blogspot.com/2014/02/white-dwarf-warhammer-visions-1.html Mr Saturday's Mumblings: White Dwarf & Warhammer Visions #1 So White Dwarf and Warhammer Visions dropped last weekend to be scrutinised by the gaming public for any signs of weakness or deformity. ... mr saturdaywhite dwarfwarhammer visionsmumblings https://grognardia.blogspot.com/2022/06/white-dwarf-issue-39.html GROGNARDIA: White Dwarf: Issue #39 Issue #39 (March 1983) of White Dwarf sports not only a cover by Nicholas Bibby (who also did last month's cover ) but also a new cover log... white dwarfgrognardiaissue https://grognardia.blogspot.com/2021/12/white-dwarf-issue-19.html GROGNARDIA: White Dwarf: Issue #19 Issue #19 of White Dwarf (June/July 1980) features a wonderfully creepy cover illustration by Les Edwards, which I am certain I have seen be... white dwarfgrognardiaissue https://littleodo.blogspot.com/2012/02/white-dwarf-386-february-2012.html Little Odo's Grand Days Out: White Dwarf 386 - February 2012 A blog about tabletop wargaming, role playing and other gaming linked activities including: archaeology, history, comics and other mainstream media little ododays outwhite dwarfgrand https://science.nasa.gov/missions/hubble/water-rich-planetary-building-blocks-found-around-white-dwarf/ Water-rich Planetary Building Blocks Found Around White Dwarf - NASA Science Mar 20, 2025 - Astronomers using NASA's Hubble Space Telescope have found the building blocks of solid planets that are capable of having substantial amounts of water. This building blockswhite dwarfwaterrichplanetary https://grognardia.blogspot.com/2022/06/white-dwarf-issue-37.html?m=0 GROGNARDIA: White Dwarf: Issue #37 Issue #37 of White Dwarf (January 1983) features a cover by Emmanuel that I assume is inspired by an article within entitled "Faeries," abou... white dwarfgrognardiaissue https://grognardia.blogspot.com/2021/09/white-dwarf-issue-10.html?m=0 GROGNARDIA: White Dwarf: Issue #10 Issue #10 of White Dwarf (December 1978/January 1979) features a striking cover by Eddie Jones. It's the kind of funky blend of science fict... white dwarfgrognardiaissue https://grognardia.blogspot.com/2022/04/white-dwarf-issue-34.html?m=0 GROGNARDIA: White Dwarf: Issue #34 Issue #34 of White Dwarf (October 1982) features a cover by Emmanuel, the artist responsible for the cover of the Fiend Folio . Although it'... white dwarfgrognardiaissue https://sites.bu.edu/buwd/people/ People | White Dwarf Group white dwarfpeoplegroup https://realmofchaos80s.blogspot.com/2012/06/white-dwarf-archive-wd-issue-91-july.html?m=0 Realm of Chaos 80s: White Dwarf Archive: WD Issue 91 July 1987 Here it is as promised. The first in a fairly irregular series of reviews of key issues of WD missing from the online torrents. This week, i... realm of chaoswhite dwarf https://apocalypse40k.blogspot.com/2012/04/dark-angels-rumors-white-dwarf-mystery.html Heresy30K - The Horus Heresy Blog: Dark Angels Rumors - The White Dwarf Mystery Well, you have to be living under an asteroid to not know that Games Workshop has been putting a mystery image on the spine of White Dwar... the horus heresyblog darkwhite dwarf https://natfka.blogspot.com/2013/01/no-more-rules-in-white-dwarf.html No More Rules in White Dwarf - Faeit 212 So reading through this rumor, it seems that someone from the design team is upset that rules are being released in White Dwarf. I am no... no morein whiterulesdwarf https://grognardia.blogspot.com/2021/09/white-dwarf-issue-11.html GROGNARDIA: White Dwarf: Issue #11 Issue #11 of White Dwarf (February/March 1979) features a very odd cover painting by John Blanche. I'm not quite sure what it's supposed to ... white dwarfgrognardiaissue https://ub01.uni-tuebingen.de/xmlui/handle/10900/143165 A helium-burning white dwarf binary as a supersoft X-ray source white dwarfx rayheliumburning https://tomsche69.blogspot.com/2018/07/white-dwarf-july-2018.html An Old Belgian Otaku: White Dwarf July 2018 My geeky adventures in the wonderful world of anime and wargaming, and things that catch my fancy ;-) white dwarfoldbelgianotakujuly https://grognardia.blogspot.com/2021/10/white-dwarf-issue-13.html?m=1 GROGNARDIA: White Dwarf: Issue #13 Issue #13 of White Dwarf (June/July 1979) features a cover by Eddie Jones that recalls Robert E. Howard's Conan the Cimmerian (or at least t... white dwarfgrognardiaissue https://science.nasa.gov/asset/hubble/comet-like-object-falling-toward-white-dwarf-artists-concept/ Comet-Like Object Falling Toward White Dwarf (Artist's Concept) - NASA Science Aug 17, 2025 - This artist's concept shows a massive, comet-like object falling toward a white dwarf. New Hubble Space Telescope findings are evidence for a belt of... white dwarf https://grognardia.blogspot.com/2022/09/white-dwarf-issue-51.html?m=1 GROGNARDIA: White Dwarf: Issue #51 Issue #51 of White Dwarf (March 1984) features a cover by Iain McCaig, an artist many will know from his work in the film industry, as well ... white dwarfgrognardiaissue https://pure.psu.edu/en/publications/exotic-compact-objects-the-dark-white-dwarf/ Exotic compact objects: The dark white dwarf - Penn State compact objectsthe darkwhite dwarfexoticpenn https://natfka.blogspot.com/2015/02/missing-white-dwarf-content-is-now.html?m=0 Missing White Dwarf Content is Now Available - Faeit 212 It seems that the digital version of White Dwarf 55 had the "Rules" section missing for the Starweaver and Voidweaver. This is now fixed a... is now availablewhite dwarfmissingcontent https://www.southampton.ac.uk/research/projects/helium-shell-white-dwarf-explosions-leading-to-unusual-transient-phenomena Helium-shell White Dwarf Explosions Leading To Unusual Transient Phenomena | University of... Helium-shell White Dwarf Explosions Leading To Unusual Transient Phenomena. white dwarf https://graphiteprime.blogspot.com/2025/10/the-white-dwarf-necromancer.html Graphite Prime: The White Dwarf Necromancer graphite primethe whitedwarfnecromancer https://par.nsf.gov/biblio/10473907 All-sky Faint DA White Dwarf Spectrophotometric Standards for Astrophysical Observatories: The... This page contains metadata information for the record with PAR ID 10473907 all skywhite dwarf https://natfka.blogspot.com/2016/01/leaked-images-from-white-dwarf-new.html?m=0 Leaked Images from White Dwarf.. New Fyreslayer Battlescrolls - Faeit 212 New Fyreslayer character images are now making the rounds along with the cover of this coming week's White Dwarf. The Grimwrath Beserker ... white dwarfleakedimagesnewfyreslayer https://paintsngluenrocknroll.blogspot.com/2014/07/white-dwarf-pirate.html Nord's Painting Saga: White Dwarf Pirate The White Dwarf subscriber only figure from a couple of years back, painted as a birthday gift for my brother. I know it's ancient histo... white dwarfnordpaintingsagapirate https://science.nasa.gov/asset/hubble/white-dwarf-accreting-icy-object-illustration/ White Dwarf Accreting Icy Object (Illustration) - NASA Science Sep 18, 2025 - This artist's concept shows a white dwarf surrounded by a large debris disk. Debris from pieces of a captured, Pluto-like object is falling onto the white... white dwarficyobjectillustrationnasa https://grognardia.blogspot.com/2022/02/white-dwarf-issue-25.html GROGNARDIA: White Dwarf: Issue #25 Issue #25 of White Dwarf (June/July 1981) features a cover by Fiend Folio cover artist, Emmanuel. In addition, Emmanuel provides all of the... white dwarfgrognardiaissue https://grognardia.blogspot.com/2022/11/white-dwarf-issue-57.html GROGNARDIA: White Dwarf: Issue #57 Issue #57 of White Dwarf (September 1984) features a cover by an artist credited only as Tweddell. The image is certainly an eye-catching on... white dwarfgrognardiaissue https://natfka.blogspot.com/2012/07/csms-not-in-new-white-dwarf.html CSMs Not In the New White Dwarf! - Faeit 212 So rumors are coming in that Chaos Space Marines are not going to be released in August. In reality they are saying that the Chaos Space... not inthe newwhite dwarfcsms https://writingaboutmusic.blogspot.com/2016/11/megaritual-mantra-music-white-dwarf.html Scott's Music Reviews: Megaritual- Mantra Music (White Dwarf WHD006) Megaritual is the solo project of Australian multi-instrumentalist Dale Walker (from the band of Sun Of Man). I have nev... scott smusic reviewswhite dwarfmantra https://natfka.blogspot.com/2012/11/january-white-dwarf-will-feature-dark.html January White Dwarf Will Feature Dark Angels - Faeit 212 Here is a little snippet sent in to me which gives us a timeline for an exciting end the year, first of 2013 codex release for 40k. Acco... white dwarfdark angelsjanuaryfeature https://grognardia.blogspot.com/2022/12/white-dwarf-issue-61.html?m=0 GROGNARDIA: White Dwarf: Issue #61 Issue #61 of White Dwarf (January 1985) has a very strange cover by Chris Achilleos. I'm not sure if the armored bird (?) man with a whip is... white dwarfgrognardiaissue https://dailydwarfblog.wordpress.com/ The @DailyDwarf Blog | Blogging about the halcyon days of White Dwarf Blogging about the halcyon days of White Dwarf halcyon daysblogwhitedwarf https://nrc-publications.canada.ca/eng/view/object/?id=08e4876a-d0cb-4efe-8f02-d72e96be074e The Pulsar/White Dwarf/Planet system in M4 : Improved astrometry - NRC Publications Archive -... The Pulsar/White Dwarf/Planet system in M4 : Improved astrometry https://paintsngluenrocknroll.blogspot.com/2014/04/free-white-dwarf.html?showComment=1398191292623 Nord's Painting Saga: Free White Dwarf I have piles! It's a serious problem, but you can help. This is my pile of old White Dwarfs, stuck in a couple of boxes in the loft for ye... nordpaintingsagafreewhite https://recalcitrantdaze.blogspot.com/2016/05/into-archives-my-early-white-dwarf.html Recalcitrant Daze: Into The Archives - My Early White Dwarf Reads (Part Two) White Dwarf #125 Here we delve into the next White Dwarf I held onto. Dave Gallagher provides the cover artwork titled 'Ork Nobz' fo... into the archivesrecalcitrant daze https://lnu.diva-portal.org/smash/record.jsf?pid=diva2:308541 Fluorescence Fe II lines as traces of fast outflows of white dwarf winds