https://folio-org.atlassian.net/wiki/spaces/COMMUNITY/overview?mode=global
Welcome to the FOLIO Wiki - Community - FOLIO Wiki
welcome towiki communityfolio
https://caddy.community/t/caddy-cloudflare-tunnel/15929
Caddy + Cloudflare tunnel - Wiki - Caddy Community
I just got a particular Caddy setup working after hours of trying out various things, and wanted to share. I was looking to have a fully Dockerized setup that...
cloudflare tunnelwiki communitycaddy
https://caddy.community/t/caddy-as-a-proxmox-reverse-proxy/20477
Caddy as a Proxmox Reverse Proxy - Wiki - Caddy Community
If you are: Running Proxmox Annoyed by having to address port 8006 in your browser’s URL bar to access the GUI Disinterested in doing all this NGINX...
reverse proxywiki communitycaddyproxmox
https://caddy.community/t/caddy-and-allowing-traffic-only-from-cloudflare-tutorial/20797
Caddy and allowing traffic only from Cloudflare tutorial - Wiki - Caddy Community
Here is a short recipe for wiring your Caddy so that all HTTP/HTTPS traffic outside Cloudflare is blocked. The main use case is to ensure that no one performs...
wiki communitycaddytrafficcloudflaretutorial
https://caddy.community/t/ssl-configuration-in-caddy/15535
SSL Configuration in Caddy - Wiki - Caddy Community
SSL Configuration in Caddy Caddy is inbuild with SSL configuration when we use the tls directive with the Caddyfile configuration. Default SSL Configuration...
wiki communitysslconfigurationcaddy
https://caddy.community/t/load-balancing-caddy/10467
Load balancing Caddy - Wiki - Caddy Community
Most people use Caddy as their load balancer to great benefit. But sometimes you are running on a cloud service that does load balancing for you, and you find...
load balancingwiki communitycaddy
https://en.bitcoin.it/wiki/Bitcoin_Wiki:Community_portal
Bitcoin Wiki:Community portal - Bitcoin Wiki
bitcoin wikicommunity portal
https://caddy.community/t/caddy-v2-configuration-nextcloud-docker-php-fpm-with-rules-from-htaccess/20662
Caddy v2 configuration: Nextcloud Docker PHP-FPM with rules from .htaccess - Wiki - Caddy Community
TL;DR: Here I paste you my (semi-opinionated) Caddyfile for Nextcloud in Docker with PHP-FPM. I’ve seen a lot of configurations for Nextcloud but none of them...
wiki communitycaddyv2configurationnextcloud
Sponsored https://haremvilla.net/
Harem Villa - Free RPG Dating Sim for PC & Mobile
Play Harem Villa, the addictive merge puzzle game where you restore a luxury villa and romance stunning characters. Free dating sim on PC & Mobile!
https://caddy.community/t/caddy-podcasts-and-videos/10024
Caddy podcasts and videos - Wiki - Caddy Community
Most recent first Caddy Chronicles with Matt Holt | Backend Banter 037 Caddy author live streams (streams by @matt) Curated Caddy playlist on YouTube...
podcasts and videoswiki communitycaddy
https://caddy.community/t/writing-a-caddy-json-config-from-scratch/7524
Writing a Caddy JSON config from scratch - Wiki - Caddy Community
Using JSON can be tedious but has numerous advantages, including the ability to easily generate and consume the structure in almost any programming language,...
json configfrom scratchwiki communitywritingcaddy
https://caddy.community/t/caddy-reverse-proxy-nextcloud-collabora-vaultwarden-with-local-https/12052
Caddy reverse proxy + Nextcloud + Collabora + Vaultwarden with local HTTPS - Wiki - Caddy Community
1. TL;DR This Wiki contains the info to setup a frontend Caddy reverse proxy service with a Let’s Encrypt authorized TLS certificate and a backend host running...
reverse proxywiki communitycaddynextcloudcollabora
https://caddy.community/t/using-caddy-for-incident-management-in-a-home-network/11848
Using Caddy for incident management in a home network - Wiki - Caddy Community
Scope This article serves as an adjunct to the wiki article Using Caddy as a reverse proxy in a home network. It provides some ideas on how Caddy can be used...
incident managementhome networkwiki communityusingcaddy
https://caddy.community/t/caddy-with-cloudflare-tunnel/18569
Caddy with Cloudflare Tunnel - Wiki - Caddy Community
This is a basic guide to using Cloudflared Tunnel with Caddy on FreeBSD. Prerequisites Have a domain registered with Clouflare. Have a working Caddy instance...
cloudflare tunnelwiki communitycaddy
https://caddy.community/t/running-caddy-2-on-android/13993
Running Caddy 2 on Android - Wiki - Caddy Community
Caddy 2 can run on Android. There are several ways to do this without rooting your device. NOTE: Due to Android’s permission model, Caddy’s functionality might...
caddy 2on androidwiki communityrunning
https://caddy.community/t/separation-of-duty-with-caddy-remote-administration/24684
Separation of Duty with Caddy Remote Administration - Wiki - Caddy Community
Assuming your organization has two different teams who are responsible for two different subdomains besides the main domain name, you would have a Caddyfile...
wiki communityseparationdutycaddyremote
https://caddy.community/t/why-caddy-emits-empty-200-ok-responses-by-default/17634
Why Caddy emits empty 200 OK responses by default - Wiki - Caddy Community
We regularly get inquiries or complaints about Caddy emitting a 200 response for a request that was successful, but not configured to be handled. An empty 200...
200 okwiki communitycaddyemptyresponses
https://caddy.community/t/datadog-and-caddy-integration/16911
Datadog and Caddy integration - Wiki - Caddy Community
Back in the day, I posted a question about how to pull Caddy stats into the Datadog monitoring platform. Because the original thread is closed, I will post the...
wiki communitydatadogcaddyintegration
https://caddy.community/t/using-caddy-instead-of-lighttpd-with-pi-hole/8087
Using Caddy instead of lighttpd with Pi-Hole - Wiki - Caddy Community
You can use Caddy + php-fpm to access Pi Hole’s web interface without lighttpd. This guide assumes you already have Caddy installed and running. Security note:...
wiki communityusingcaddyinsteadlighttpd
https://caddy.community/t/using-caddy-as-a-reverse-proxy-in-a-home-network/9427
Using Caddy as a reverse proxy in a home network - Wiki - Caddy Community
If you want to run a service inside a Local Area Network (LAN) such as your home or office – and especially if you want to be able to access it from outside...
reverse proxyin homewiki communityusingcaddy
https://caddy.community/t/using-caddy-to-keep-certificates-renewed/7525
Using Caddy to keep certificates renewed - Wiki - Caddy Community
You can use Caddy as an automated certificate manager to keep certificates renewed without having to run an HTTPS server [1]. This way, the certificates can be...
wiki communityusingcaddykeepcertificates
https://caddy.community/t/tutorial-convert-a-nginx-conf-to-caddy-config/18853
Tutorial: convert a nginx conf to caddy config - Wiki - Caddy Community
This guide is a tutorial of how to convert a nginx config to caddy config. Nginx config only include bare minimal blocks for brevity, without surrounding...
wiki communitytutorialconvertnginxconf
https://caddy.community/t/rewrite-rule-to-caddy-2-for-gnuboard-5-4/9009
Rewrite rule to caddy 2 for Gnuboard 5.4 - Wiki - Caddy Community
I often use gnuboard which is used a lot in Korea. It is a situation where rewrite is required to make a long address short. Here are the rewrite rules for...
caddy 2wiki communityrewriterule
https://caddy.community/t/using-caddy-to-give-wordpress-its-own-directory/13185
Using Caddy to give WordPress its own directory - Wiki - Caddy Community
A Caddy makeover of the WordPress support page Giving WordPress Its Own Directory It’s possible to have your website served from the webroot, but have...
to givewiki communityusingcaddywordpress
https://caddy.community/t/how-to-use-lets-encrypt-staging-endpoint-with-caddy/18514
How to use Let's Encrypt staging endpoint with Caddy - Wiki - Caddy Community
If you’re setting up your server for the first time or testing a new network or domain configuration and you are using Let’s Encrypt (one of Caddy’s default...
how to usewiki communityletencryptstaging
https://caddy.community/t/example-docker-nextcloud-fpm-caddy-v2-webserver/9407
Example: Docker Nextcloud-FPM + Caddy v2 webserver - Wiki - Caddy Community
The Nextcloud Quick reference on Docker Hub states that there are two versions (apache or fpm) of the Nextcloud image. The apache version contains a full...
wiki communityexampledockernextcloudfpm
https://caddy.community/t/making-caddy-logs-more-readable/7565
Making Caddy logs more readable - Wiki - Caddy Community
Hello I open this thread to discuss strategies to use the JSON logs created by Caddy 2. Since I’m mostly using the command tail to consume the logs directly in...
wiki communitymakingcaddylogsreadable
https://caddy.community/t/using-caddy-to-harden-wordpress/13575
Using Caddy to harden WordPress - Wiki - Caddy Community
Caddy equivalent code for specific sections of the WordPress support article Hardening WordPress . Securing wp-includes # For a Caddy web server, use a named...
wiki communityusingcaddyhardenwordpress
Sponsored https://www.flirt4free.com/
Free Live Sex Cams and Adult Chat | Flirt4Free
https://caddy.community/t/serving-tens-of-thousands-of-domains-over-https-with-caddy/11179
Serving tens of thousands of domains over HTTPS with Caddy - Wiki - Caddy Community
This guide is a free sample of what is available exclusively for sponsors in my Expert Caddy series, where I help you master the ways of the Caddy web server....
tens of thousandswiki communityservingdomainshttps
https://caddy.community/t/how-to-use-dns-provider-modules-in-caddy-2/8148
How to use DNS provider modules in Caddy 2 - Wiki - Caddy Community
Caddy 2 uses a new and improved DNS provider interface for solving the ACME DNS challenge. All you have to do is plug the service provider(s) you need into...
how to usecaddy 2wiki communitydnsprovider
https://caddy.community/t/caddy-goaccess-log-file-analysis/9356
Caddy / GoAccess log file analysis - Wiki - Caddy Community
I really like GoAccess (https://goaccess.io/) as a tool for convenient and quick analysis of access logs . . . it shares a philosophy, if not its development...
log filewiki communitycaddygoaccessanalysis
https://caddy.community/t/running-caddy-with-wordpress-php-fpm-with-docker-compose/21526
Running Caddy with Wordpress (php-fpm) with docker compose - Wiki - Caddy Community
This is a “clone and go” docker stack where you can setup a Caddy instance and host a Wordpress site in a few minutes. Docker and compose files are separated...
docker composewiki communityrunningcaddywordpress
https://wiki.filezilla-project.org/FileZilla_Wiki:Community_portal
FileZilla Wiki:Community portal - FileZilla Wiki
wiki communityfilezillaportal
https://caddy.community/t/goaccess-log-file-analysis-for-caddy/31246
GoAccess Log File Analysis for Caddy - Wiki - Caddy Community
This setup lets you analyze Caddy access logs with GoAccess and view real-time web stats via webstats.example.com, served directly by your Caddy server. It...
log filewiki communitygoaccessanalysiscaddy
https://caddy.community/search?q=%23wiki%20
Search results for '#wiki ' - Caddy Community
Discussion about Caddy and the modern Web
search resultscaddy communitywiki
https://help.ubuntu.com/community/
CommunityHelpWiki - Community Help Wiki
community help wiki
https://discuss.privacyguides.net/c/community-wiki/9411/none
Community Wiki - Privacy Guides Community
This wiki includes guides, tips, and examples written by members of the Privacy Guides community. All content is created and edited by members of our...
community wikiprivacy guides
https://community.kde.org/Kdenlive
Kdenlive - KDE Community Wiki
kde communitykdenlivewiki
https://wiki.ietf.org/group/irtf
IRTF Wiki | IETF Community Wiki
irtfwikiietfcommunity
https://caddy.community/c/wiki/13
Wiki - Caddy Community
Community-contributed guides, examples, and tutorials.
caddy communitywiki
https://wiki.f-list.net/Special:WhatLinksHere/Community_Help
Pages that link to "Community Help" - F-List Wiki
link tocommunity helppageslistwiki
https://community.kde.org/Matrix
Matrix - KDE Community Wiki
kde communitymatrixwiki
https://archive.paragonwiki.com/wiki/Main_Page
Paragon Wiki Archive - A City of Heroes Community Wiki
city of heroesparagonwikiarchivecommunity
https://wiki.vronlinux.org/docs/community/
Community | Linux VR Adventures Wiki
Community# You can join us on Matrix or Discord, come hang out! Matrix Discord
communitylinuxvradventureswiki
https://community.kde.org/Frameworks
Frameworks - KDE Community Wiki
kde communityframeworkswiki
https://caddy.community/t/example-cockpit/8283
Example: Cockpit - Wiki - Caddy Community
Cockpit is a web interface for managing a server. It creates it’s own self signed certificate by default. Here is how to configure cockpit behind caddy to have...
caddy communityexamplecockpitwiki
https://wikiofthrones.com/
Wiki of Thrones - A Game of Thrones community for filming news, theories, games, discussions
May 16, 2024 - A Game of Thrones community for filming news, theories, games, discussions and lots more
wikithronesgamecommunityfilming
https://help.ubuntu.com/community/SSH_VPN
SSH_VPN - Community Help Wiki
community help wikisshvpn
https://atproto.wiki/en/home
AT Protocol Community Wiki | AT Protocol Community Wiki
Homepage of the AT Protocol Community Wiki
at protocolcommunity wiki
https://openwall.info/wiki/john
John the Ripper user community resources [Openwall Community Wiki]
john the ripperuser communityresourceswiki
https://community.kde.org/Incubator
Incubator - KDE Community Wiki
kde communityincubatorwiki
https://community.kde.org/Get_Involved/promotion
Get Involved/promotion - KDE Community Wiki
get involvedkde communitypromotionwiki
https://help.ubuntu.com/community/ParentalControls
ParentalControls - Community Help Wiki
community help wiki
https://openmrs.atlassian.net/wiki/spaces/docs/pages/26258573/OpenMRS+Community
OpenMRS Community - Documentation - OpenMRS Wiki
openmrs communitydocumentation wiki
Sponsored https://rencontredouce.com/
RencontreDouce
Less swiping. More actually meeting.
https://inkbunny.net/j/55419
Wiki is down - moving it to a new host by Inkbunny Journal | Inkbunny, the Furry Art Community
Hi everyone Some of you may have noticed the Inkbunny Wiki is down. We're moving it to a new host and it's taking a bit longer to than expected to get the new...
a newwikimovinghostinkbunny
https://caddy.community/t/trusted-proxies-with-cloudflare-my-solution/16124
Trusted Proxies with Cloudflare - my solution - Wiki - Caddy Community
Been struggling to figure out how to deal with the v2.5 changes to reverse_proxy while using Cloudflare as a cloud proxy service and figured I’d share what’s...
trusted proxiescaddy communitycloudflaresolutionwiki
https://blog.wikimedia.gr/wiki-loves-monuments/
Wiki Loves Monuments – Wikimedia Community User Group Greece
Το Wiki Loves Monuments (WLM) είναι ετήσιος διεθνής φωτογραφικός διαγωνισμός που διεξάγεται τον Οκτώβριο, οργανωμένος σε όλο τον κόσμο από τα μέλη της...
wiki loves monumentsuser groupwikimediacommunitygreece
https://caddy.community/t/composing-in-the-caddyfile/8291
Composing in the Caddyfile - Wiki - Caddy Community
Web server config files are mostly about expressing HTTP handling logic. Often, various handlers or middlewares need to be “composed” to form a cohesive HTTP...
in thecaddy communitycomposingcaddyfilewiki
https://xenforo.com/community/resources/xf2-8wr-xencarta-2-wiki-pro.6393/
XF2 [8WR] XenCarta 2 (Wiki) PRO | XenForo community
Jul 19, 2024 - BRANDING REMOVAL can be purchased HERE ($50) This is a complete rewrite of my light-weight wiki for XenForo. XenCarta is not designed to be a full-fledged...
wikiproxenforocommunity
https://wiki.ietf.org/en/group/iotdir
IOTDIR - Internet-of-Things Directorate | IETF Community Wiki
Initial landing page for IoT Directorate
internet of thingscommunity wikidirectorateietf
https://community.kde.org/Promotion/This_week_in_KDE
Promotion/This week in KDE - KDE Community Wiki
this weekkde communitypromotionwiki
https://community.kde.org/KDE_Linux/Develop_other_non-KDE_software
KDE Linux/Develop other non-KDE software - KDE Community Wiki
kde linuxcommunity wikidevelopnonsoftware
https://community.kde.org/Calligra/Libs/KoXmlReader
Calligra/Libs/KoXmlReader - KDE Community Wiki
kde communitycalligralibswiki
Sponsored https://xtease.com/
Xtease - Strip Cam Live & Strip Tease Shows – Hot Adult Chat
Watch the hottest strip cams and live strip tease shows on Xtease. Join now for real-time adult chat and connect instantly with your favorite teasing models.
https://community.kde.org/Plasma/Docker_Images
Plasma/Docker Images - KDE Community Wiki
docker imageskde communityplasmawiki
https://doc.tiki.org/Documentation
Documentation by Tiki community members just like you | Documentation for Tiki Wiki CMS Groupware
Tiki Wiki CMS Groupware Official Documentation
community membersdocumentationtikilikewiki
https://caddy.community/t/my-color-log-configuration/14028
My color log configuration - Wiki - Caddy Community
I spent some time making a pretty colored log format that maybe you might like to use as well. This uses the transform encoder plugin: Place this in your...
caddy communitycolorlogconfigurationwiki
https://community.kde.org/KDE_Community_Wiki:Privacy_policy
KDE Community Wiki:Privacy policy - KDE Community Wiki
kde communityprivacy policywiki
https://community.kde.org/Mentoring
Mentoring - KDE Community Wiki
kde communitymentoringwiki
https://caddy.community/t/example-wordpress/7888
Example: WordPress - Wiki - Caddy Community
First, make sure WordPress is set up and running with php-fpm. A minimal Caddyfile config is: example.com { root * /var/www/wordpress encode gzip php_fastcgi...
caddy communityexamplewordpresswiki
https://ffxiv.consolegameswiki.com/wiki/FF14_Wiki
Final Fantasy XIV Online Wiki - FFXIV / FF14 Online Community Wiki and Guide
final fantasy xivonlinewikiffxivff14
https://caddy.community/t/shortlived-certificates-from-lets-encrypt/33399
Shortlived certificates (from Let's Encrypt) - Wiki - Caddy Community
This is not a help topic. Just sharing my new config… Shortlived 6-day certificates have become generally available since Jan 15, 2026. Ref: 6-day and IP...
caddy communitycertificatesletencryptwiki
https://community.kde.org/Get_Involved/accessibility
Get Involved/accessibility - KDE Community Wiki
get involvedkde communityaccessibilitywiki
https://community.kde.org/Get_Involved/documentation
Get Involved/documentation - KDE Community Wiki
get involvedkde communitydocumentationwiki
https://meta.wikimedia.org/wiki/Special:MyLanguage/PhilWiki_Community
PhilWiki Community - Meta-Wiki
communitymetawiki