Robuta

https://folio-org.atlassian.net/wiki/spaces/COMMUNITY/overview?mode=global Welcome to the FOLIO Wiki - Community - FOLIO Wiki welcome towiki communityfolio https://caddy.community/t/caddy-cloudflare-tunnel/15929 Caddy + Cloudflare tunnel - Wiki - Caddy Community I just got a particular Caddy setup working after hours of trying out various things, and wanted to share. I was looking to have a fully Dockerized setup that... cloudflare tunnelwiki communitycaddy https://caddy.community/t/caddy-as-a-proxmox-reverse-proxy/20477 Caddy as a Proxmox Reverse Proxy - Wiki - Caddy Community If you are: Running Proxmox Annoyed by having to address port 8006 in your browser’s URL bar to access the GUI Disinterested in doing all this NGINX... reverse proxywiki communitycaddyproxmox https://caddy.community/t/caddy-and-allowing-traffic-only-from-cloudflare-tutorial/20797 Caddy and allowing traffic only from Cloudflare tutorial - Wiki - Caddy Community Here is a short recipe for wiring your Caddy so that all HTTP/HTTPS traffic outside Cloudflare is blocked. The main use case is to ensure that no one performs... wiki communitycaddytrafficcloudflaretutorial https://caddy.community/t/ssl-configuration-in-caddy/15535 SSL Configuration in Caddy - Wiki - Caddy Community SSL Configuration in Caddy Caddy is inbuild with SSL configuration when we use the tls directive with the Caddyfile configuration. Default SSL Configuration... wiki communitysslconfigurationcaddy https://caddy.community/t/load-balancing-caddy/10467 Load balancing Caddy - Wiki - Caddy Community Most people use Caddy as their load balancer to great benefit. But sometimes you are running on a cloud service that does load balancing for you, and you find... load balancingwiki communitycaddy https://en.bitcoin.it/wiki/Bitcoin_Wiki:Community_portal Bitcoin Wiki:Community portal - Bitcoin Wiki bitcoin wikicommunity portal https://caddy.community/t/caddy-v2-configuration-nextcloud-docker-php-fpm-with-rules-from-htaccess/20662 Caddy v2 configuration: Nextcloud Docker PHP-FPM with rules from .htaccess - Wiki - Caddy Community TL;DR: Here I paste you my (semi-opinionated) Caddyfile for Nextcloud in Docker with PHP-FPM. I’ve seen a lot of configurations for Nextcloud but none of them... wiki communitycaddyv2configurationnextcloud Sponsored https://haremvilla.net/ Harem Villa - Free RPG Dating Sim for PC & Mobile Play Harem Villa, the addictive merge puzzle game where you restore a luxury villa and romance stunning characters. Free dating sim on PC & Mobile! https://caddy.community/t/caddy-podcasts-and-videos/10024 Caddy podcasts and videos - Wiki - Caddy Community Most recent first Caddy Chronicles with Matt Holt | Backend Banter 037 Caddy author live streams (streams by @matt) Curated Caddy playlist on YouTube... podcasts and videoswiki communitycaddy https://caddy.community/t/writing-a-caddy-json-config-from-scratch/7524 Writing a Caddy JSON config from scratch - Wiki - Caddy Community Using JSON can be tedious but has numerous advantages, including the ability to easily generate and consume the structure in almost any programming language,... json configfrom scratchwiki communitywritingcaddy https://caddy.community/t/caddy-reverse-proxy-nextcloud-collabora-vaultwarden-with-local-https/12052 Caddy reverse proxy + Nextcloud + Collabora + Vaultwarden with local HTTPS - Wiki - Caddy Community 1. TL;DR This Wiki contains the info to setup a frontend Caddy reverse proxy service with a Let’s Encrypt authorized TLS certificate and a backend host running... reverse proxywiki communitycaddynextcloudcollabora https://caddy.community/t/using-caddy-for-incident-management-in-a-home-network/11848 Using Caddy for incident management in a home network - Wiki - Caddy Community Scope This article serves as an adjunct to the wiki article Using Caddy as a reverse proxy in a home network. It provides some ideas on how Caddy can be used... incident managementhome networkwiki communityusingcaddy https://caddy.community/t/caddy-with-cloudflare-tunnel/18569 Caddy with Cloudflare Tunnel - Wiki - Caddy Community This is a basic guide to using Cloudflared Tunnel with Caddy on FreeBSD. Prerequisites Have a domain registered with Clouflare. Have a working Caddy instance... cloudflare tunnelwiki communitycaddy https://caddy.community/t/running-caddy-2-on-android/13993 Running Caddy 2 on Android - Wiki - Caddy Community Caddy 2 can run on Android. There are several ways to do this without rooting your device. NOTE: Due to Android’s permission model, Caddy’s functionality might... caddy 2on androidwiki communityrunning https://caddy.community/t/separation-of-duty-with-caddy-remote-administration/24684 Separation of Duty with Caddy Remote Administration - Wiki - Caddy Community Assuming your organization has two different teams who are responsible for two different subdomains besides the main domain name, you would have a Caddyfile... wiki communityseparationdutycaddyremote https://caddy.community/t/why-caddy-emits-empty-200-ok-responses-by-default/17634 Why Caddy emits empty 200 OK responses by default - Wiki - Caddy Community We regularly get inquiries or complaints about Caddy emitting a 200 response for a request that was successful, but not configured to be handled. An empty 200... 200 okwiki communitycaddyemptyresponses https://caddy.community/t/datadog-and-caddy-integration/16911 Datadog and Caddy integration - Wiki - Caddy Community Back in the day, I posted a question about how to pull Caddy stats into the Datadog monitoring platform. Because the original thread is closed, I will post the... wiki communitydatadogcaddyintegration https://caddy.community/t/using-caddy-instead-of-lighttpd-with-pi-hole/8087 Using Caddy instead of lighttpd with Pi-Hole - Wiki - Caddy Community You can use Caddy + php-fpm to access Pi Hole’s web interface without lighttpd. This guide assumes you already have Caddy installed and running. Security note:... wiki communityusingcaddyinsteadlighttpd https://caddy.community/t/using-caddy-as-a-reverse-proxy-in-a-home-network/9427 Using Caddy as a reverse proxy in a home network - Wiki - Caddy Community If you want to run a service inside a Local Area Network (LAN) such as your home or office – and especially if you want to be able to access it from outside... reverse proxyin homewiki communityusingcaddy https://caddy.community/t/using-caddy-to-keep-certificates-renewed/7525 Using Caddy to keep certificates renewed - Wiki - Caddy Community You can use Caddy as an automated certificate manager to keep certificates renewed without having to run an HTTPS server [1]. This way, the certificates can be... wiki communityusingcaddykeepcertificates https://caddy.community/t/tutorial-convert-a-nginx-conf-to-caddy-config/18853 Tutorial: convert a nginx conf to caddy config - Wiki - Caddy Community This guide is a tutorial of how to convert a nginx config to caddy config. Nginx config only include bare minimal blocks for brevity, without surrounding... wiki communitytutorialconvertnginxconf https://caddy.community/t/rewrite-rule-to-caddy-2-for-gnuboard-5-4/9009 Rewrite rule to caddy 2 for Gnuboard 5.4 - Wiki - Caddy Community I often use gnuboard which is used a lot in Korea. It is a situation where rewrite is required to make a long address short. Here are the rewrite rules for... caddy 2wiki communityrewriterule https://caddy.community/t/using-caddy-to-give-wordpress-its-own-directory/13185 Using Caddy to give WordPress its own directory - Wiki - Caddy Community A Caddy makeover of the WordPress support page Giving WordPress Its Own Directory It’s possible to have your website served from the webroot, but have... to givewiki communityusingcaddywordpress https://caddy.community/t/how-to-use-lets-encrypt-staging-endpoint-with-caddy/18514 How to use Let's Encrypt staging endpoint with Caddy - Wiki - Caddy Community If you’re setting up your server for the first time or testing a new network or domain configuration and you are using Let’s Encrypt (one of Caddy’s default... how to usewiki communityletencryptstaging https://caddy.community/t/example-docker-nextcloud-fpm-caddy-v2-webserver/9407 Example: Docker Nextcloud-FPM + Caddy v2 webserver - Wiki - Caddy Community The Nextcloud Quick reference on Docker Hub states that there are two versions (apache or fpm) of the Nextcloud image. The apache version contains a full... wiki communityexampledockernextcloudfpm https://caddy.community/t/making-caddy-logs-more-readable/7565 Making Caddy logs more readable - Wiki - Caddy Community Hello I open this thread to discuss strategies to use the JSON logs created by Caddy 2. Since I’m mostly using the command tail to consume the logs directly in... wiki communitymakingcaddylogsreadable https://caddy.community/t/using-caddy-to-harden-wordpress/13575 Using Caddy to harden WordPress - Wiki - Caddy Community Caddy equivalent code for specific sections of the WordPress support article Hardening WordPress . Securing wp-includes # For a Caddy web server, use a named... wiki communityusingcaddyhardenwordpress Sponsored https://www.flirt4free.com/ Free Live Sex Cams and Adult Chat | Flirt4Free https://caddy.community/t/serving-tens-of-thousands-of-domains-over-https-with-caddy/11179 Serving tens of thousands of domains over HTTPS with Caddy - Wiki - Caddy Community This guide is a free sample of what is available exclusively for sponsors in my Expert Caddy series, where I help you master the ways of the Caddy web server.... tens of thousandswiki communityservingdomainshttps https://caddy.community/t/how-to-use-dns-provider-modules-in-caddy-2/8148 How to use DNS provider modules in Caddy 2 - Wiki - Caddy Community Caddy 2 uses a new and improved DNS provider interface for solving the ACME DNS challenge. All you have to do is plug the service provider(s) you need into... how to usecaddy 2wiki communitydnsprovider https://caddy.community/t/caddy-goaccess-log-file-analysis/9356 Caddy / GoAccess log file analysis - Wiki - Caddy Community I really like GoAccess (https://goaccess.io/) as a tool for convenient and quick analysis of access logs . . . it shares a philosophy, if not its development... log filewiki communitycaddygoaccessanalysis https://caddy.community/t/running-caddy-with-wordpress-php-fpm-with-docker-compose/21526 Running Caddy with Wordpress (php-fpm) with docker compose - Wiki - Caddy Community This is a “clone and go” docker stack where you can setup a Caddy instance and host a Wordpress site in a few minutes. Docker and compose files are separated... docker composewiki communityrunningcaddywordpress https://wiki.filezilla-project.org/FileZilla_Wiki:Community_portal FileZilla Wiki:Community portal - FileZilla Wiki wiki communityfilezillaportal https://caddy.community/t/goaccess-log-file-analysis-for-caddy/31246 GoAccess Log File Analysis for Caddy - Wiki - Caddy Community This setup lets you analyze Caddy access logs with GoAccess and view real-time web stats via webstats.example.com, served directly by your Caddy server. It... log filewiki communitygoaccessanalysiscaddy https://caddy.community/search?q=%23wiki%20 Search results for '#wiki ' - Caddy Community Discussion about Caddy and the modern Web search resultscaddy communitywiki https://help.ubuntu.com/community/ CommunityHelpWiki - Community Help Wiki community help wiki https://discuss.privacyguides.net/c/community-wiki/9411/none Community Wiki - Privacy Guides Community This wiki includes guides, tips, and examples written by members of the Privacy Guides community. All content is created and edited by members of our... community wikiprivacy guides https://community.kde.org/Kdenlive Kdenlive - KDE Community Wiki kde communitykdenlivewiki https://wiki.ietf.org/group/irtf IRTF Wiki | IETF Community Wiki irtfwikiietfcommunity https://caddy.community/c/wiki/13 Wiki - Caddy Community Community-contributed guides, examples, and tutorials. caddy communitywiki https://wiki.f-list.net/Special:WhatLinksHere/Community_Help Pages that link to "Community Help" - F-List Wiki link tocommunity helppageslistwiki https://community.kde.org/Matrix Matrix - KDE Community Wiki kde communitymatrixwiki https://archive.paragonwiki.com/wiki/Main_Page Paragon Wiki Archive - A City of Heroes Community Wiki city of heroesparagonwikiarchivecommunity https://wiki.vronlinux.org/docs/community/ Community | Linux VR Adventures Wiki Community# You can join us on Matrix or Discord, come hang out! Matrix Discord communitylinuxvradventureswiki https://community.kde.org/Frameworks Frameworks - KDE Community Wiki kde communityframeworkswiki https://caddy.community/t/example-cockpit/8283 Example: Cockpit - Wiki - Caddy Community Cockpit is a web interface for managing a server. It creates it’s own self signed certificate by default. Here is how to configure cockpit behind caddy to have... caddy communityexamplecockpitwiki https://wikiofthrones.com/ Wiki of Thrones - A Game of Thrones community for filming news, theories, games, discussions May 16, 2024 - A Game of Thrones community for filming news, theories, games, discussions and lots more wikithronesgamecommunityfilming https://help.ubuntu.com/community/SSH_VPN SSH_VPN - Community Help Wiki community help wikisshvpn https://atproto.wiki/en/home AT Protocol Community Wiki | AT Protocol Community Wiki Homepage of the AT Protocol Community Wiki at protocolcommunity wiki https://openwall.info/wiki/john John the Ripper user community resources [Openwall Community Wiki] john the ripperuser communityresourceswiki https://community.kde.org/Incubator Incubator - KDE Community Wiki kde communityincubatorwiki https://community.kde.org/Get_Involved/promotion Get Involved/promotion - KDE Community Wiki get involvedkde communitypromotionwiki https://help.ubuntu.com/community/ParentalControls ParentalControls - Community Help Wiki community help wiki https://openmrs.atlassian.net/wiki/spaces/docs/pages/26258573/OpenMRS+Community OpenMRS Community - Documentation - OpenMRS Wiki openmrs communitydocumentation wiki Sponsored https://rencontredouce.com/ RencontreDouce Less swiping. More actually meeting. https://inkbunny.net/j/55419 Wiki is down - moving it to a new host by Inkbunny Journal | Inkbunny, the Furry Art Community Hi everyone Some of you may have noticed the Inkbunny Wiki is down. We're moving it to a new host and it's taking a bit longer to than expected to get the new... a newwikimovinghostinkbunny https://caddy.community/t/trusted-proxies-with-cloudflare-my-solution/16124 Trusted Proxies with Cloudflare - my solution - Wiki - Caddy Community Been struggling to figure out how to deal with the v2.5 changes to reverse_proxy while using Cloudflare as a cloud proxy service and figured I’d share what’s... trusted proxiescaddy communitycloudflaresolutionwiki https://blog.wikimedia.gr/wiki-loves-monuments/ Wiki Loves Monuments – Wikimedia Community User Group Greece Το Wiki Loves Monuments (WLM) είναι ετήσιος διεθνής φωτογραφικός διαγωνισμός που διεξάγεται τον Οκτώβριο, οργανωμένος σε όλο τον κόσμο από τα μέλη της... wiki loves monumentsuser groupwikimediacommunitygreece https://caddy.community/t/composing-in-the-caddyfile/8291 Composing in the Caddyfile - Wiki - Caddy Community Web server config files are mostly about expressing HTTP handling logic. Often, various handlers or middlewares need to be “composed” to form a cohesive HTTP... in thecaddy communitycomposingcaddyfilewiki https://xenforo.com/community/resources/xf2-8wr-xencarta-2-wiki-pro.6393/ XF2 [8WR] XenCarta 2 (Wiki) PRO | XenForo community Jul 19, 2024 - BRANDING REMOVAL can be purchased HERE ($50) This is a complete rewrite of my light-weight wiki for XenForo. XenCarta is not designed to be a full-fledged... wikiproxenforocommunity https://wiki.ietf.org/en/group/iotdir IOTDIR - Internet-of-Things Directorate | IETF Community Wiki Initial landing page for IoT Directorate internet of thingscommunity wikidirectorateietf https://community.kde.org/Promotion/This_week_in_KDE Promotion/This week in KDE - KDE Community Wiki this weekkde communitypromotionwiki https://community.kde.org/KDE_Linux/Develop_other_non-KDE_software KDE Linux/Develop other non-KDE software - KDE Community Wiki kde linuxcommunity wikidevelopnonsoftware https://community.kde.org/Calligra/Libs/KoXmlReader Calligra/Libs/KoXmlReader - KDE Community Wiki kde communitycalligralibswiki Sponsored https://xtease.com/ Xtease - Strip Cam Live & Strip Tease Shows – Hot Adult Chat Watch the hottest strip cams and live strip tease shows on Xtease. Join now for real-time adult chat and connect instantly with your favorite teasing models. https://community.kde.org/Plasma/Docker_Images Plasma/Docker Images - KDE Community Wiki docker imageskde communityplasmawiki https://doc.tiki.org/Documentation Documentation by Tiki community members just like you | Documentation for Tiki Wiki CMS Groupware Tiki Wiki CMS Groupware Official Documentation community membersdocumentationtikilikewiki https://caddy.community/t/my-color-log-configuration/14028 My color log configuration - Wiki - Caddy Community I spent some time making a pretty colored log format that maybe you might like to use as well. This uses the transform encoder plugin: Place this in your... caddy communitycolorlogconfigurationwiki https://community.kde.org/KDE_Community_Wiki:Privacy_policy KDE Community Wiki:Privacy policy - KDE Community Wiki kde communityprivacy policywiki https://community.kde.org/Mentoring Mentoring - KDE Community Wiki kde communitymentoringwiki https://caddy.community/t/example-wordpress/7888 Example: WordPress - Wiki - Caddy Community First, make sure WordPress is set up and running with php-fpm. A minimal Caddyfile config is: example.com { root * /var/www/wordpress encode gzip php_fastcgi... caddy communityexamplewordpresswiki https://ffxiv.consolegameswiki.com/wiki/FF14_Wiki Final Fantasy XIV Online Wiki - FFXIV / FF14 Online Community Wiki and Guide final fantasy xivonlinewikiffxivff14 https://caddy.community/t/shortlived-certificates-from-lets-encrypt/33399 Shortlived certificates (from Let's Encrypt) - Wiki - Caddy Community This is not a help topic. Just sharing my new config… Shortlived 6-day certificates have become generally available since Jan 15, 2026. Ref: 6-day and IP... caddy communitycertificatesletencryptwiki https://community.kde.org/Get_Involved/accessibility Get Involved/accessibility - KDE Community Wiki get involvedkde communityaccessibilitywiki https://community.kde.org/Get_Involved/documentation Get Involved/documentation - KDE Community Wiki get involvedkde communitydocumentationwiki https://meta.wikimedia.org/wiki/Special:MyLanguage/PhilWiki_Community PhilWiki Community - Meta-Wiki communitymetawiki