https://www.wfp.org/publications/investing-ukraines-economy-and-food-systems-factsheet-july-2025
WFP works with bakeries and local food producers to deliver emergency food assistance near the frontline in Ukraine.
food systemsinvestingukraineeconomyfactsheet
https://www.weforum.org/stories/2025/01/6-key-systems-levers-for-climate-and-nature/
Global leaders align on six levers to tackle climate and nature, scaling blended finance, boosting philanthropy and driving systemic change in key regions.
keysystemsleversclimatenature
https://www.slashgear.com/2063941/most-powerful-military-air-defense-systems/
Jan 1, 2026 - Air defense power stems from a system's ability to find and take out a threat, putting mission effectiveness above considerations of range, speed, and power.
air defense systemspowerfulmilitary
https://ourworldindata.org/grapher/weighted-carbon-price-ets?tab=chart&country=CYP
The emissions-weighted carbon price in emissions trading systems (ETS) is calculated for the whole economy by multiplying each sector's (e.g. electricity, or...
carbon pricetrading systemsemissionsweightedworld
https://www.marketresearch.com/Icon-Group-International-Inc-v609/Outlook-Intravascular-Ultrasound-Systems-41672157/
The 2026-2031 World Outlook for Intravascular Ultrasound Systems This study covers the world outlook for intravascular ultrasound systems across more than 190...
world outlookintravascular ultrasoundsystems
https://wilo.com/id/en/Local-Information/Current-News/
Keep up-to-date with latest news about the company and news in the area of pumps and pump systems.
installation systemslatestworldpumps
https://www.bcorporation.net/en-us/programs-and-tools/policy-and-advocacy/
B Lab's global policy world advancing economic systems change around the world, including the Better Business Act in the UK, GITRE in Latin America, the...
b labglobal policyeconomic systemsadvancingchange
https://www.designingbuildings.co.uk/wiki/BSRIA_World_Building_Automation_and_Control_Systems_2022
BSRIA World Building Automation and Control Systems 2022 - Designing Buildings - Share your construction industry knowledge. Building automation and control...
world buildingcontrol systemsbsriaautomationdesigning
https://monthlyreview.org/the-ecological-rift-reviewed-in-journal-of-world-systems-research/
Ecological degradation is the elephant in the room for many people; they are aware of its presence yet would prefer to ignore it rather than be forced to...
world systemsecologicalriftreviewedjournal
https://www.zulupods.com/primary-applications/
Dec 23, 2024 - Novel lubrication systems for high DN, single and short mission bearings The Problem Conventional lubrications systems can be the bottleneck in your limited...
lubrication systemsprimaryzulupodsengine
https://www.informit.com/store/it-systems-management-designing-implementing-and-managing-9780130876782?w_ptgrevartcl=The+Seven+R%27s+of+High+Availability_28299
Design, implement, and manage world-class infrastructures. Develop bullet-proof processes Implement proven systems management techniques Streamline your IT...
systems managementworld classdesigningimplementingmanaging
https://www.c-sharpcorner.com/article/understanding-rabbitmq-in-real-world-net-systems-why-when-and-how-to-use-it/
Unlock resilient .NET systems with RabbitMQ! Learn how to decouple services, handle failures gracefully, and improve performance with practical C# examples. A...
real worldunderstandingrabbitmqnetsystems
https://stackshare.io/rafay-systems/kubecon-2019-takeaway-we-live-in-a-multi-cluster-and-multi-distro-world
Discover the tech stack used by Rafay Systems. Explore 8 tools across 1 categories.
kubecontakeawaylivemulticluster
https://www.weforum.org/stories/2020/11/how-to-create-sustainable-food-systems/
Major, far-reaching sustainability transitions are needed to provide a growing population with nutritious, safe, healthy, affordable and sustainable food
feedgrowingworldneedchange
https://altimeda.com/
Altimeda designs and builds AI-ready data lakehouse platforms, enterprise systems, and GenAI assistants for construction, mining, manufacturing, and industrial...
building aienterprise systemscomfirstmodern
https://www.marketresearch.com/Icon-Group-International-Inc-v609/Outlook-Automated-Passenger-Counting-Systems-43821627/
The 2027-2032 World Outlook for Automated Passenger Counting Systems This study covers the world outlook for automated passenger counting systems across more...
world outlookpassenger countingautomatedsystems
https://streamyard.com/watch/rmHPRM3EYvAW?embed=true
In 2024, customers no longer perceive financial services as just a necessity. Instead, with the economic decline pressure, they long for more clarity, a sense...
lessons learnedlargest banksmarketingmessagesystems
https://www.weforum.org/stories/2020/05/covid-19-reveals-gaps-in-public-health-system-who-briefing/
Major gaps in public health investment are undermining health, security and economic development around the globe, the World Health Organization said Wednesday.
health systemscovidrevealsgapsbriefing
https://insidegnss.com/?cat=1384,1371,1376,1369,1378,1375,1381,1382,1377,1383
Jun 9, 2023 - Global Navigation Satellite Systems Engineering, Policy, and Design
global navigationsatellite systemsgnssworldarchives
https://hkust.edu.hk/news/wonderful-world-5-g-wireless-systems
The world is now using the 4-G wireless systems but the research community is already hard at work creating the next generation 5-G wireless systems, expected...
wonderful worldwireless systemsg
https://worldjusticeproject.org/news/what-data-says-about-criminal-justice-systems-around-world
From the United States to the Philippines to the International Criminal Court, criminal justice is making headlines around the world.
criminal justicedatasayssystemsaround
https://www.wri.org/climate
WRI helps policymakers, businesses and civil society at the local, national and international levels advance the systems change necessary for climate action.
systems changeadvancingneededfightclimate
https://www.republicworld.com/business/prostarm-info-systems-ipo-check-gmp-date-price-band-lot-size-and-key-details
The initial public offering (IPO) of the Integrated power solution company Prostarm Info Systems Ltd opened for subscription on Monday.
price bandinfosystemsipocheck
https://wilo.com/il/en/Local-Information/Current-News/index.html
Keep up-to-date with latest news about the company and news in the area of pumps and pump systems.
installation systemslatestworldpumps
https://ourworldindata.org/grapher/test-scores-ai-capabilities-relative-human-performance
Within each domain, the initial performance of the AI is set to –100. Human performance is used as a baseline, set to zero. When the AI’s performance...
test scoresai systemsvariouscapabilitiesrelative
https://www.cnx-software.com/news/embedded-world-2012/page/2/
Read the latest embedded world 2012 news on CNX Software - Embedded Systems News
embedded worldnewscnxsoftware
https://www.redhat.com/it/blog/harden-your-ai-systems-applying-industry-standards-real-world
Learn about the evolving AI security and safety threat landscape, drawing from leading efforts such as MITRE ATLAS, NIST, OWASP, and others. Discover...
ai systemsindustry standardshardenapplyingreal
https://www.weforum.org/organizations/d-wave-systems/
Founded in 1999, D-Wave Systems is the world's first quantum computing company. Its mission is to integrate new discoveries in physics, engineering,...
world economic forumwavesystems
https://www.tno.nl/en/digital/artificial-intelligence/safe-autonomous-systems/autonomous-systems-real-world/?ctc-page=1
Are autonomous systems like self-driving cars also safe without human input? TNO develops hybrid AI algorithms for this purpose. Read more.
autonomous systemsreal worldtno
https://www.guitarworld.com/reviews/ld-systems-maui-5-go-100-review
A compact, take-anywhere PA system that could be a godsend for those needing high-fidelity audio for audiences of up to 100 people
ld systemsguitar worldmauigoreview
https://www.nist.gov/publications/smoke-management-systems-federal-building-and-fire-safety-investigation-world-trade
This report documents the design and installation of the smoke management systems in World Trade Center (WTC) 1, 2, and 7 and compares the designs to the requir
smoke management systemsfederal buildingfire safetyinvestigation
https://trellis.net/article/three-ways-agri-businesses-can-feed-world-sustainably-through-circular-food-systems/
Companies should be paying more for more environmentally friendly food sources, spending money on technologies to reduce food waste and figuring out new...
three waysagribusinessesfeedworld
https://www.weforum.org/publications/green-returns-unleashing-the-power-of-finance-for-sustainable-food-systems/
This paper is a direct call to the finance community to reshape its strategies, incentivize across the value chain with innovative financial tools and invest...
sustainable foodgreenreturnsunleashingpower
https://trakkasystems.com/trakka-systems-acquired-by-world-leading-aviation-company-acron-aviation/
Nov 5, 2025 - November 5, 2025 — Bradenton, Fla – 29 October 2025 — Trakka Systems (“Trakka”), a global leader in integrated electro-optical and infrared imaging...
aviation companytrakkasystemsacquiredworld
https://www.cctvcameraworld.com/
CCTV Camera World is a direct supplier of security cameras and security systems backed by expert technical support. Call (877) 522-8836 today.
security camerassystemscctvworld
https://changelog.com/podcast/624
Elecia White, host of Embedded.fm and author of Making Embedded Systems, joins us to discuss all things embedded systems. We discuss programming non-computers,...
embedded systemschangelog interviewsworldwhite
https://ourworldindata.org/grapher/cumulative-number-of-large-scale-ai-systems-by-country
Refers to the location of the primary organization with which the authors of a large-scale AI systems are affiliated.
large scaleai systemscumulativenumbercountry
https://oilquickamericas.com/
Automatic quick coupler systems for excavators, wheel loaders, lift trucks, Lorry cranes and material handling machines
quick couplerworldleadingsystems
https://oikoumene.org/news/churches-promote-just-financial-systems-at-the-world-social-forum-in-tunisia
The increasingly influential role of the financial sector, its impact on communities and their struggles toward a just financial system remained the focus of...
world social forumfinancial systemschurchespromote
https://www.prweb.com/releases/pi-showcases-industrial-grade-precision-motion-and-alignment-systems-at-laser-world-of-photonics-2025-302483390.html
/PRNewswire-PRWeb/ -- At the 2025 LASER World of PHOTONICS in Munich, Germany — the world's largest laser and photonics conference — PI, a global leader...
industrial gradeprecision motionalignment systemspishowcases
https://dimdex.com/News/world-leading-missile-systems-developer-mbda-returns-to-dimdex-stage-as-gold-sponsor/
Jan 15, 2020 - World-Leading Missile Systems Developer MBDA Returns to DIMDEX Stage as Gold Sponsor
missile systemsworldleadingdevelopermbda
https://reliefweb.int/report/world/covid-crises-highlight-strengths-democratic-systems-says-guterres
News and Press Release in English on World about Protection and Human Rights and Epidemic; published on 15 Sep 2021 by UN News
covidcriseshighlightstrengthsdemocratic
https://www.databricks.com/glossary/agentic-ai
Discover agentic AI systems: how autonomous AI agents make decisions, execute complex tasks, and transform industries through minimal human intervention.
agentic aiautonomous systemsunderstanding
https://ourworldindata.org/grapher/weighted-carbon-price-ets?tab=chart&country=FRA
The emissions-weighted carbon price in emissions trading systems (ETS) is calculated for the whole economy by multiplying each sector's (e.g. electricity, or...
carbon pricetrading systemsemissionsweightedworld
https://www.weforum.org/stories/2023/07/systems-thinking-education-future/
Traditional educational models are no longer sufficient to meet the demands of a dynamic global society. Instead, we need to help students develop systems...
world economic forumsystems thinkingembededucation
https://www.europeanbusinessreview.com/why-fire-safety-systems-work-on-paper-but-fail-in-practice/
Nov 2, 2025 - Explore why fire safety systems succeed on paper but often fail in real situations, and how to fix the gaps.
fire safety systemsreal worldfailpractice
https://physicsworld.com/a/d-wave-systems-claims-quantum-advantage-but-some-physicists-are-not-convinced/
Mar 31, 2025 - Firm’s quantum annealer simulates magnetic phase transitions
quantum advantagewavesystemsclaimsphysicists
https://www.weforum.org/stories/2023/07/building-resilient-healthcare-systems-in-africa-with-a-focus-on-outbreaks-and-epidemics/
Africa is facing an increase in epidemics and its healthcare systems are severely challenged. This is how the continent is preparing for future outbreaks.
world economic forumhealthcare systemsbuildingafricanresilient
https://trainingzone.co.uk/systems-coaching-an-exciting-new-trend-in-the-coaching-world/
We are delighted this week to feature another guest blogger, Lorna Shaw. If you would like to blog on a theme related to Challenging Coaching then please get...
new trendsystemscoachingexcitingworld
https://www.jost-world.com/de/
Weltweit führend in Systemen für Nutzfahrzeuge – Sattelkupplungen, Anhängekupplungen, Lenksysteme, Frontlader & mehr. Über 70 Jahre Erfolg und Innovation.
smart systemsjost worldnutzfahrzeuge
https://www.ul.com/zh-hans/sis/training/practical-aspects-safety-analysis
Advanced training dedicated to automotive systems development that benefit from safety analysis with a practical approach.
automotive systemsreal worldtrainingapproachsis
https://www.weforum.org/stories/2026/01/what-bruneis-innovations-teach-data-driven-health-systems/
Non-communicable diseases account for more than 70% of global deaths, yet the data infrastructure health systems rely on to prevent, track, and treat them...
data driven healthteach usbruneisystems
https://www.ibtimes.co.uk/inside-systems-powering-worlds-data-decisions-1771186
Jan 15, 2026 - With years of experience building systems used across large and complex institutions, software engineer Nadira Pranatio believes data infrastructure will shape...
insidesystemspoweringworlddata
https://www.all4dairy.com/
The ultimate management systems in cattle care, create accurate scorings and bovine records with ease for all members of the dairy industry.
world classcare managementcattlesystems
https://www.ucl.ac.uk/news/2020/aug/opinion-countries-around-world-are-using-border-surveillance-systems-against-their-own
Dr Keren Weitzberg (UCL History) comments on the plight of stateless citizens who struggle to move outside refugee status, and on the harms of data-driven...
border surveillanceopinioncountriesaroundworld
https://jphmpdirect.com/the-wide-world-of-public-health-systems/
Sep 24, 2024 - The Wide World of Public Health Systems is a regular series in which JP Leider and colleagues from the University of Minnesota Center for Public Health Systems...
wide worldpublic healthsystemsdirect
https://www.t-systems.com/es/es/insights/events/oracle-ai-world-tour-2026-madrid
T-Systems patrocina y participa en este evento dedicado a la inteligencia artificial en el entorno empresarial.
oracle aiworld tourmadridsystems
https://www.natureworldnews.com/articles/4466/20131016/world-ocean-systems-undergo-major-upheaval-2100-due-climate-change.htm
A holistic new study examining the full series of changes that have and will be triggered in the world's oceans through human-derived greenhouse gas emissions...
world oceansystemsundergomajorupheaval
https://www.lancaster.ac.uk/study/undergraduate/courses/mathematics-artificial-intelligence-and-realworld-systems-mars-msci-hons-g1i7/2026/
Find out more about studying Mathematics, Artificial Intelligence, and Real-world Systems (MARS) MSci Hons (G1I7) at Lancaster University
artificial intelligencereal worldmathematicssystemsmars