https://know-aml.com/
Know AML | Acute Myeloid Leukemia awareness initiative
Know AML is the first global AML awareness initiative that provides patients, caregivers, and healthcare professionals with information, resources, and support.
acute myeloid leukemiaknowamlawarenessinitiative
https://pmc.ncbi.nlm.nih.gov/articles/PMC11592599/
Acute Myeloid Leukemia: Diagnosis and Evaluation by Flow Cytometry - PMC
Acute myeloid leukemia (AML) is a heterogeneous group of diseases characterized by the clonal proliferation of immature myeloid precursors. The diagnosis and...
acute myeloid leukemiadiagnosis and evaluationflow cytometrypmc
https://pure.psu.edu/en/publications/impact-of-depth-of-clinical-response-on-outcomes-of-acute-myeloid/
Impact of depth of clinical response on outcomes of acute myeloid leukemia patients in first...
acute myeloid leukemia
https://sj.jst.go.jp/news/202604/n0410-02k.html
New treatment strategy for acute myeloid leukemia proposed by Tokai University | News | Science...
New treatment strategy for acute myeloid leukemia proposed by Tokai University
acute myeloid leukemia
https://www.cancer.columbia.edu/cancer-types-care/types/leukemia/leukemia-types/acute-myeloid-leukemia-aml
Acute Myeloid Leukemia (AML) | Herbert Irving Comprehensive Cancer Center (HICCC) - New York
Aug 22, 2025 - Learn about the risk factors, symptoms, diagnosis, and treatment of AML.
acute myeloid leukemiacomprehensive cancer center
https://rarediseases.info.nih.gov/diseases/17450/inherited-acute-myeloid-leukemia
Inherited acute myeloid leukemia | About the Disease | GARD
Find symptoms and other information about Inherited acute myeloid leukemia.
acute myeloid leukemiaabout the diseaseinheritedgard
https://www.sciencedaily.com/releases/2015/04/150429234631.htm
Scientists identify key receptors behind development of acute myeloid leukemia | ScienceDaily
Scientists have discovered that a certain class of receptors that inhibit immune response are crucial for the development of acute myeloid leukemia (AML), the...
acute myeloid leukemiascientistsidentifykeyreceptors
https://scholars.uky.edu/en/publications/discovery-of-a-diaminopyrimidine-flt3-inhibitor-active-against-ac/
Discovery of a Diaminopyrimidine FLT3 Inhibitor Active against Acute Myeloid Leukemia - University...
acute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/31824594/
Gingival hyperplasia as an early manifestation of acute myeloid leukemia. A retrospective review
acute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/41952620/
Disease course of FLT3 mutated extramedullary acute myeloid leukemia and efficacy of gilteritinib
acute myeloid leukemia
https://scholars.uky.edu/en/projects/fy23-artesunate-as-treatment-for-childhood-acute-myeloid-leukemia/
FY23 Artesunate as Treatment for Childhood Acute Myeloid Leukemia - University of Kentucky
acute myeloid leukemiatreatment for
https://personaldevblog.web.app/tags/AML%2C%20Acute%20Myeloid%20Leukemia
Tag: AML, Acute Myeloid Leukemia | The Engineer's Alpha
Posts with the tag: AML, Acute Myeloid Leukemia
acute myeloid leukemiathe engineertagamlalpha
https://kidshealth.org/WillisKnighton/en/parents/aml.html
Acute Myeloid Leukemia (AML) (for Parents) - Willis Knighton Health
Acute myeloid leukemia (AML) happens when the body makes too many immature white blood cells. With treatment, most kids recover.
acute myeloid leukemiafor parentsamlwillisknighton
https://www.cancer.gov/types/leukemia/patient/adult-aml-treatment-pdq
Acute Myeloid Leukemia Treatment - NCI
Treatment options for adult acute myeloid leukemia (AML) include chemotherapy, radiation therapy, stem cell transplant, and other medications. Get detailed...
acute myeloid leukemiatreatmentnci
https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Pathophysiology.aspx
Acute Myeloid Leukemia Pathophysiology
Jun 10, 2023 - Cancer arises when the genes and DNA within the cell are damaged. In a normal cell this DNA guides the actions, functions, growth, maturity, division and...
acute myeloid leukemiapathophysiology
https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCI-2017-00278&r=1
Study of Biomarker-Based Treatment of Acute Myeloid Leukemia - NCI
Study of Biomarker-Based Treatment of Acute Myeloid Leukemia
acute myeloid leukemiastudybiomarkerbasedtreatment
https://pubmed.ncbi.nlm.nih.gov/36476927/
[Research Progress of Cytokines in the Prognosis of Acute Myeloid Leukemia --Review]
At present, acute myeloid leukemia (AML) is mainly treated with combination medication, high-dose, and early intensification. The treatment has achieved good...
acute myeloid leukemiaresearch progressin thecytokines
https://simple.wikipedia.org/wiki/Category:Deaths_from_acute_myeloid_leukemia
Category:Deaths from acute myeloid leukemia - Simple English Wikipedia, the free encyclopedia
acute myeloid leukemiasimple english wikipedia
https://umu.diva-portal.org/smash/record.jsf?pid=diva2:901416
Acute Myeloid Leukemia in Adolescents and Young Adults Treated in Pediatric and Adult Departments...
adolescents and young adultsacute myeloid leukemia
https://boris-portal.unibe.ch/entities/publication/feb40b99-3b20-4b4e-9dfc-0e18e3a81647
Reducing FASN expression sensitizes acute myeloid leukemia cells to differentiation therapy.
Fatty acid synthase (FASN) is the only human lipogenic enzyme available for de novo fatty acid synthesis and is often highly expressed in cancer cells. We...
acute myeloid leukemiareducingfasnexpression
https://fast.wistia.net/embed/iframe/upry7v8hpn?autoplay=true
Acute Myeloid Leukemia (AML)_ Utilizing Single-Cell Multi-Omics to Uncover its Evolution and...
acute myeloid leukemia
https://www.cancer.org/cancer/types/acute-myeloid-leukemia/treating/radiation-therapy.html
Radiation Therapy for Acute Myeloid Leukemia (AML) | American Cancer Society
Radiation therapy is a treatment that uses high-energy rays or particles to destroy acute myeloid leukemia cells. Learn more here.
acute myeloid leukemiaradiation therapyamlamericancancer
https://www.globenewswire.com/news-release/2024/06/17/2899698/0/en/Acute-Myeloid-Leukemia-is-on-the-Rise-as-Biotechs-Race-to-Develop-Groundbreaking-Therapies.html
Acute Myeloid Leukemia is on the Rise as Biotechs Race to
PALM BEACH, Fla., June 17, 2024 (GLOBE NEWSWIRE) -- FN Media Group News Commentary - Acute Myeloid Leukemia (AML) is a type of cancer that affects the...
acute myeloid leukemiaon the rise
https://foodsystems.uw.edu/project/nutrition-support-of-an-acute-myeloid-leukemia-patient/
Nutrition Support of an Acute Myeloid Leukemia Patient | Food Systems, Nutrition, and Health
School of Public Health
acute myeloid leukemianutrition support
https://docs.google.com/spreadsheets/d/1_KyfeZNsepIxSU0Nzw5Mi8mk1PiKCWlSBjatw0AECQ0/edit
Acute Myeloid Leukemia - Google Sheets
acute myeloid leukemiagooglesheets
https://clarivate.com/life-sciences-healthcare/report/nrlfon0006-2017-biopharma-acute-myeloid-leukemia-niche-rare-disease-landscape-forecast-us-eu5-2017/
Acute Myeloid Leukemia | Niche & Rare Disease Landscape & Forecast | US/EU5 | 2017 | Clarivate
Acute myeloid leukemia is the most common form of acute leukemia in adults. Its incidence in the major pharmaceutical markets under study is increasing,...
acute myeloid leukemiarare disease
https://news.med.virginia.edu/research/uva-research-leads-to-new-drug-for-deadliest-blood-cancer/attachment/acute-myeloid-leukemia-illustration/
Acute myeloid leukemia, illustration - Medicine in Motion News
Dec 1, 2025 - Acute myeloid leukemia (AML), illustration. This cancer affects the myeloid tissue (bone marrow), specifically the white blood cell precursors (myeloblasts)...
acute myeloid leukemiain motionillustrationmedicinenews
https://www.cancer.org/cancer/types/acute-myeloid-leukemia/about/key-statistics.html
Key Statistics for Acute Myeloid Leukemia (AML) | American Cancer Society
The American Cancer Society's most recent estimates and statistics for acute myeloid leukemia in the United States are located here.
acute myeloid leukemiakey statisticsamlamericancancer
https://research.monash.edu/en/publications/clinicopathological-aspects-of-therapy-related-acute-myeloid-leuk/
Clinicopathological aspects of therapy-related acute myeloid leukemia and myelodysplastic syndrome...
acute myeloid leukemiaaspectstherapyrelated
https://pubmed.ncbi.nlm.nih.gov/40829168/
Proteomic subtypes enrich current acute myeloid leukemia nomenclature and reflect intrinsic...
Acute myeloid leukemia (AML) is a highly heterogeneous hematological malignancy that increasingly affects the older population, with its posttranscriptional...
acute myeloid leukemiaproteomicsubtypesenrichcurrent
https://pubmed.ncbi.nlm.nih.gov/35356209/
Daemonorops draco Blume Induces Apoptosis Against Acute Myeloid Leukemia Cells via Regulation of...
acute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/19509382/
Allogeneic stem cell transplantation for acute myeloid leukemia in first complete remission:...
Compared with nonallogeneic SCT therapies, allogeneic SCT has significant RFS and overall survival benefit for intermediate- and poor-risk AML but not for...
stem cell transplantationacute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/35678031/
Characteristics and outcome of patients with acute myeloid leukemia and trisomy 4
We retrospectively studied 125 patients with acute myeloid leukemia and trisomy 4 (median age at diagnosis, 58 years; range, 16-77 years) treated between 2000...
acute myeloid leukemiacharacteristicsoutcomepatients
https://umu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A901416&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all
Acute Myeloid Leukemia in Adolescents and Young Adults Treated in Pediatric and Adult Departments...
adolescents and young adultsacute myeloid leukemia
https://portal.fis.tum.de/en/publications/gemtuzumab-ozogamicin-in-npm1-mutated-acute-myeloid-leukemia-earl/fingerprints/
Gemtuzumab ozogamicin in NPM1-mutated acute myeloid leukemia: Early results from the prospective...
acute myeloid leukemia
https://scholars.lib.ntu.edu.tw/entities/project/7467db8c-c749-42bd-8258-09990636feb0
Hypermetylation of Multiple Suppressor Gene p15INK4B in Acute Myeloid Leukemia and Its Aapplication...
acute myeloid leukemia
https://portal.research.lu.se/sv/projects/investigating-downstream-molecular-pathways-of-flt3-in-acute-myel/
Investigating Downstream Molecular Pathways of FLT3 in Acute Myeloid Leukemia: Unraveling Molecular...
acute myeloid leukemiainvestigatingdownstreammolecularpathways
https://ecommons.cornell.edu/entities/publication/44797b91-5d89-45b9-8ca7-fbd446a884ec
A case of acute myeloid leukemia in an adult Golden Retriever
This paper will discuss the case of a 9 year old male castrated Golden Retriever which presented to the oncology service on 7/12/04 with a referral for...
acute myeloid leukemiaan adultcase
https://pmc.ncbi.nlm.nih.gov/articles/PMC3983612/
Preclinical targeting of human acute myeloid leukemia and myeloablation using chimeric antigen...
Targeting of CD123 via CAR-engineered T cells results in rejection of human AML and myeloablation in mouse models.
acute myeloid leukemia
https://pure.psu.edu/en/publications/nonbiological-factors-affecting-survival-in-younger-patients-with/
Nonbiological factors affecting survival in younger patients with acute myeloid leukemia - Penn...
acute myeloid leukemia
https://scholars.lib.ntu.edu.tw/entities/project/1fe02c35-b5eb-4bd3-b454-d54c78788277
Bone Marrow Angiogenesis in Acute Myeloid Leukemia---Evaluated by Dynamic Contrast Enhanced MR...
acute myeloid leukemia
https://news.weill.cornell.edu/news/2021/01/new-maintenance-treatment-for-acute-myeloid-leukemia-prolongs-the-lives-of-patients
New Maintenance Treatment for Acute Myeloid Leukemia Prolongs the Lives of Patients | Newsroom |...
Patients with acute myeloid leukemia that has gone into remission following initial chemotherapy remain in remission longer and have improved overall survival...
acute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/32560251/
Targeting Pharmacokinetic Drug Resistance in Acute Myeloid Leukemia Cells with CDK4/6 Inhibitors
Pharmacotherapy of acute myeloid leukemia (AML) remains challenging, and the disease has one of the lowest curability rates among hematological malignancies....
acute myeloid leukemia
https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Causes.aspx
Acute Myeloid Leukemia Causes
Jun 10, 2023 - Acute myeloid leukaemia (AML) starts when the DNA and genes in the stem cells of the bone marrow undergo change known as genetic mutation. This leads to...
acute myeloid leukemiacauses
https://www.mdpi.com/2077-0383/11/1/253
Prevention and Treatment of Acute Myeloid Leukemia Relapse after Hematopoietic Stem Cell...
Allogeneic hematopoietic stem cell transplantation (HSCT) for high-risk acute myeloid leukemia (AML) represents the only curative option. Progress has been...
prevention and treatmentacute myeloid leukemia
https://www.biochem.mpg.de/proteogenomics-identifies-novel-acute-myeloid-leukemia-subtypes
Proteogenomics identifies novel acute myeloid leukemia subtypes | Max Planck Institute of...
Researchers at the MPI of Biochemistry, together with collaborating partners, have discovered the first proteomic subtype of an aggressive blood cancer known...
acute myeloid leukemiamax planck instituteidentifiesnovel
https://scholars.lib.ntu.edu.tw/entities/publication/a6c4689f-4ad1-4445-8c18-1abe4b23b8f9
Improved Treatment Results for Childhood Acute Myeloid Leukemia in Taiwan
To improve treatment results for children with de novo acute myeloid leukemia (AML), we introduced a novel protocol, Taiwan Pediatric Oncology Group-AML-97A,...
acute myeloid leukemiatreatment resultsimprovedchildhoodtaiwan
https://pubmed.ncbi.nlm.nih.gov/39936576/
Acute Myeloid Leukemia: 2025 Update on Diagnosis, Risk-Stratification, and Management
The availability of 12 newly approved agents has been welcomed; however, optimal strategies incorporating newer agents into therapeutic algorithms are debated....
acute myeloid leukemiarisk stratificationupdate
https://www.cancer.org/cancer/types/acute-myeloid-leukemia/causes-risks-prevention/risk-factors.html
Risk Factors for Acute Myeloid Leukemia (AML) | American Cancer Society | American Cancer Society
Certain risk factors may increase your chance of developing acute myeloid leukemia. This guide will help you learn about possible causes.
acute myeloid leukemiarisk factorsamlamericancancer
https://portal.fis.tum.de/de/publications/gemtuzumab-ozogamicin-in-npm1-mutated-acute-myeloid-leukemia-earl/
Gemtuzumab ozogamicin in NPM1-mutated acute myeloid leukemia: Early results from the prospective...
acute myeloid leukemia
https://pubmed.ncbi.nlm.nih.gov/28137827/
S100A9 induces differentiation of acute myeloid leukemia cells through TLR4
S100A8 and S100A9 are calcium-binding proteins predominantly expressed by neutrophils and monocytes and play key roles in both normal and pathological...
acute myeloid leukemiadifferentiationcells
https://pmc.ncbi.nlm.nih.gov/articles/PMC12523351/
T-Cell Engagers in Acute Myeloid Leukemia: Molecular Targets, Structure, and Therapeutic Challenges...
Acute myeloid leukemia remains difficult to treat due to its high relapse rates after standard therapies. T-cell engagers are a promising new approach that...
acute myeloid leukemia
https://researchconnect.buffalo.edu/en/publications/dexrazoxane-for-cardioprotection-in-older-adults-with-acute-myelo/
Dexrazoxane for cardioprotection in older adults with acute myeloid leukemia - SUNY University at...
acute myeloid leukemia
https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCT03836209&r=1
Gilteritinib vs Midostaurin in FLT3 Mutated Acute Myeloid Leukemia - NCI
Gilteritinib vs Midostaurin in FLT3 Mutated Acute Myeloid Leukemia
acute myeloid leukemiavsmidostaurinmutatednci
https://pubmed.ncbi.nlm.nih.gov/8609707/
Epipodophyllotoxin-related acute myeloid leukemia: a study of 35 cases
To define better the risk of epipodophyllotoxin-related acute myeloid leukemia (AML) after extended follow-up and to assess responses to intensive salvage...
acute myeloid leukemiarelatedstudycases
https://experts.arizona.edu/en/publications/translating-genetic-questions-into-clinical-answers-in-acute-myel/
Translating genetic questions into clinical answers in acute myeloid leukemia - University of...
acute myeloid leukemia
https://www.semanticscholar.org/topic/Acute-Myeloid-Leukemia-Arising-from-Previous/258715
Acute Myeloid Leukemia Arising from Previous Myelodysplastic Syndrome | Semantic Scholar
An acute myeloid leukemia developing in patients with a prior history of myelodysplastic syndrome.
acute myeloid leukemiamyelodysplastic syndromearisingprevioussemantic
https://english.cas.cn/newsroom/research-news/202604/t20260410_1155637.shtml
New DNMT1 Inhibitor Overcomes HMA Resistance in Acute Myeloid Leukemia----Chinese Academy of...
acute myeloid leukemia
https://pure.psu.edu/en/publications/successful-treatment-of-relapsed-pediatric-acute-myeloid-leukemia/
Successful Treatment of Relapsed Pediatric Acute Myeloid Leukemia Presenting as Central Nervous...
acute myeloid leukemia
https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Diagnosis.aspx
Acute Myeloid Leukemia Diagnosis
Jun 10, 2023 - If a patients presents with the symptoms of acute myeloid leukemia a battery of tests are ordered. The tests used to diagnose AML include the following.
acute myeloid leukemiadiagnosis
https://pmc.ncbi.nlm.nih.gov/articles/PMC6207763/
Cortisol facilitates the immune escape of human acute myeloid leukemia cells by inducing...
acute myeloid leukemia
https://vivo.colorado.edu/display/pubid_277615
IncRNA requirements for mouse acute myeloid leukemia and normal differentiation | CU Experts | CU...
acute myeloid leukemia
https://www.frontiersin.org/journals/oncology/articles/10.3389/fonc.2021.748250/full
Frontiers | Biomarkers in Acute Myeloid Leukemia: Leveraging Next Generation Sequencing Data for...
Next generation sequencing (NGS) is routinely used for mutation profiling of acute myeloid leukemia (AML). The extensive application of NGS in hematologic ma...
acute myeloid leukemianext generation sequencing
https://medlineplus.gov/genetics/condition/familial-acute-myeloid-leukemia-with-mutated-cebpa/
Familial acute myeloid leukemia with mutated CEBPA: MedlinePlus Genetics
Familial acute myeloid leukemia with mutated CEBPA is one form of a cancer of the blood-forming tissue ( bone marrow ) called acute myeloid leukemia. Explore...
acute myeloid leukemiafamilialmutatedmedlineplusgenetics
https://pubmed.ncbi.nlm.nih.gov/36149183/
Acute myeloid leukemia and myelofibrosis: Simultaneous transformation of essential thrombocythemia...
Essential thrombocytosis (ET) is usually an indolent disease but can uncommonly evolve into acute myeloid leukemia (AML) with a grim prognosis of 2-7 months....
acute myeloid leukemiamyelofibrosissimultaneoustransformationessential
https://pubmed.ncbi.nlm.nih.gov/27373815/
Prevalence and Clinical Significance of FLT3 Mutation Status in Acute Myeloid Leukemia Patients: A...
Prevalence of FLT3-ITD mutation in AML was present in a proportion comparable to other populations and, when present, was associated with a very poor prognosis.
https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCI-2024-01721&r=1
Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable...
Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable Residual Disease
https://pubmed.ncbi.nlm.nih.gov/36130297/
Genomic profiling for clinical decision making in myeloid neoplasms and acute leukemia
Myeloid neoplasms and acute leukemias derive from the clonal expansion of hematopoietic cells driven by somatic gene mutations. Although assessment of...
clinical decision makinggenomic profiling
https://pubmed.ncbi.nlm.nih.gov/38632314/
KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia
KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia
https://adisinsight.springer.com/trials/700308326?error=cookies_not_supported&code=5303b7d7-3418-4513-86b1-677c2ec4e767
A phase 1 clinical trial of TK-216 in patients with relapsed acute myeloid leukemia (AML) -...
This study will evaluate TK-216 in patients with relapsed acute myeloid leukemia (AML).
https://adisinsight.springer.com/trials/700392486?error=cookies_not_supported&code=df99c4de-43a6-4741-b287-9a3665d27da7
To evaluate a novel immunotherapy for acute myeloid leukemia (AML) that uses universal killer T...
This study is to evaluate a novel immunotherapy for acute myeloid leukemia (AML) that uses universal killer T cells derived from iPS cells.
https://pubmed.ncbi.nlm.nih.gov/21030981/
PHF6 mutations in adult acute myeloid leukemia
Loss of function mutations and deletions encompassing the plant homeodomain finger 6 (PHF6) gene are present in about 20% of T-cell acute lymphoblastic...
mutationsadultacutemyeloidleukemia
https://cordis.europa.eu/project/id/101153517
SMART-AML: Shaping Marrow Adiposity to Redefine Treatment in Acute Myeloid Leukemia | SMART-AML |...
Acute Myeloid Leukemia (AML) is an aggressive hematologic malignancy characterized by the uncontrolled proliferation of myeloid cells, which hijack the bone...
https://pure.psu.edu/en/publications/healthcare-costs-and-utilization-for-patients-age-50-to-64-years-/
Healthcare Costs and Utilization for Patients Age 50 to 64 Years with Acute Myeloid Leukemia...
https://hsbiblio.uni-tuebingen.de/xmlui/handle/10900/124575
DNAM-1/CD226 is functionally expressed on acute myeloid leukemia (AML) cells and is associated with...
https://pmc.ncbi.nlm.nih.gov/articles/PMC8997036/
Use of Venetoclax in Patients with Relapsed or Refractory Acute Myeloid Leukemia: The PETHEMA...
The use of venetoclax combined with hypomethylating agents or low-dose cytarabine in patients with newly diagnosed acute myeloid leukemia unfit for intensive...
https://pmc.ncbi.nlm.nih.gov/articles/PMC27754/
t(11;22)(q23;q11.2) in acute myeloid leukemia of infant twins fuses MLL with hCDCrel, a cell...
We examined the MLL genomic translocation breakpoint in acute myeloid leukemia of infant twins. Southern blot analysis in both cases showed two identical MLL...
https://collaborate.princeton.edu/en/publications/genomic-and-epigenomic-landscapes-of-adult-de-novo-acute-myeloid-/
Genomic and epigenomic landscapes of adult de novo acute myeloid leukemia - Princeton University
https://scholars.uky.edu/es/publications/discovery-of-a-diaminopyrimidine-flt3-inhibitor-active-against-ac/
Discovery of a Diaminopyrimidine FLT3 Inhibitor Active against Acute Myeloid Leukemia -
of adiscovery
https://refubium.fu-berlin.de/handle/fub188/15028?locale-attribute=en
Refubium - Unrelated donor versus matched sibling donor in adults with acute myeloid leukemia in...
https://open.bu.edu/items/c94a9e44-12db-4069-84e9-0a691d6606b5
Factors associated with intensity of end-of-life care for patients with acute myeloid leukemia
https://pmc.ncbi.nlm.nih.gov/articles/PMC7072334/
Harnessing T Cells to Target Pediatric Acute Myeloid Leukemia: CARs, BiTEs, and Beyond - PMC
Outcomes for pediatric patients with acute myeloid leukemia (AML) remain poor, highlighting the need for improved targeted therapies. Building on the success...