Robuta

https://know-aml.com/ Know AML | Acute Myeloid Leukemia awareness initiative Know AML is the first global AML awareness initiative that provides patients, caregivers, and healthcare professionals with information, resources, and support. acute myeloid leukemiaknowamlawarenessinitiative https://pmc.ncbi.nlm.nih.gov/articles/PMC11592599/ Acute Myeloid Leukemia: Diagnosis and Evaluation by Flow Cytometry - PMC Acute myeloid leukemia (AML) is a heterogeneous group of diseases characterized by the clonal proliferation of immature myeloid precursors. The diagnosis and... acute myeloid leukemiadiagnosis and evaluationflow cytometrypmc https://pure.psu.edu/en/publications/impact-of-depth-of-clinical-response-on-outcomes-of-acute-myeloid/ Impact of depth of clinical response on outcomes of acute myeloid leukemia patients in first... acute myeloid leukemia https://sj.jst.go.jp/news/202604/n0410-02k.html New treatment strategy for acute myeloid leukemia proposed by Tokai University | News | Science... New treatment strategy for acute myeloid leukemia proposed by Tokai University acute myeloid leukemia https://www.cancer.columbia.edu/cancer-types-care/types/leukemia/leukemia-types/acute-myeloid-leukemia-aml Acute Myeloid Leukemia (AML) | Herbert Irving Comprehensive Cancer Center (HICCC) - New York Aug 22, 2025 - Learn about the risk factors, symptoms, diagnosis, and treatment of AML. acute myeloid leukemiacomprehensive cancer center https://rarediseases.info.nih.gov/diseases/17450/inherited-acute-myeloid-leukemia Inherited acute myeloid leukemia | About the Disease | GARD Find symptoms and other information about Inherited acute myeloid leukemia. acute myeloid leukemiaabout the diseaseinheritedgard https://www.sciencedaily.com/releases/2015/04/150429234631.htm Scientists identify key receptors behind development of acute myeloid leukemia | ScienceDaily Scientists have discovered that a certain class of receptors that inhibit immune response are crucial for the development of acute myeloid leukemia (AML), the... acute myeloid leukemiascientistsidentifykeyreceptors https://scholars.uky.edu/en/publications/discovery-of-a-diaminopyrimidine-flt3-inhibitor-active-against-ac/ Discovery of a Diaminopyrimidine FLT3 Inhibitor Active against Acute Myeloid Leukemia - University... acute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/31824594/ Gingival hyperplasia as an early manifestation of acute myeloid leukemia. A retrospective review acute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/41952620/ Disease course of FLT3 mutated extramedullary acute myeloid leukemia and efficacy of gilteritinib acute myeloid leukemia https://scholars.uky.edu/en/projects/fy23-artesunate-as-treatment-for-childhood-acute-myeloid-leukemia/ FY23 Artesunate as Treatment for Childhood Acute Myeloid Leukemia - University of Kentucky acute myeloid leukemiatreatment for https://personaldevblog.web.app/tags/AML%2C%20Acute%20Myeloid%20Leukemia Tag: AML, Acute Myeloid Leukemia | The Engineer's Alpha Posts with the tag: AML, Acute Myeloid Leukemia acute myeloid leukemiathe engineertagamlalpha https://kidshealth.org/WillisKnighton/en/parents/aml.html Acute Myeloid Leukemia (AML) (for Parents) - Willis Knighton Health Acute myeloid leukemia (AML) happens when the body makes too many immature white blood cells. With treatment, most kids recover. acute myeloid leukemiafor parentsamlwillisknighton https://www.cancer.gov/types/leukemia/patient/adult-aml-treatment-pdq Acute Myeloid Leukemia Treatment - NCI Treatment options for adult acute myeloid leukemia (AML) include chemotherapy, radiation therapy, stem cell transplant, and other medications. Get detailed... acute myeloid leukemiatreatmentnci https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Pathophysiology.aspx Acute Myeloid Leukemia Pathophysiology Jun 10, 2023 - Cancer arises when the genes and DNA within the cell are damaged. In a normal cell this DNA guides the actions, functions, growth, maturity, division and... acute myeloid leukemiapathophysiology https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCI-2017-00278&r=1 Study of Biomarker-Based Treatment of Acute Myeloid Leukemia - NCI Study of Biomarker-Based Treatment of Acute Myeloid Leukemia acute myeloid leukemiastudybiomarkerbasedtreatment https://pubmed.ncbi.nlm.nih.gov/36476927/ [Research Progress of Cytokines in the Prognosis of Acute Myeloid Leukemia --Review] At present, acute myeloid leukemia (AML) is mainly treated with combination medication, high-dose, and early intensification. The treatment has achieved good... acute myeloid leukemiaresearch progressin thecytokines https://simple.wikipedia.org/wiki/Category:Deaths_from_acute_myeloid_leukemia Category:Deaths from acute myeloid leukemia - Simple English Wikipedia, the free encyclopedia acute myeloid leukemiasimple english wikipedia https://umu.diva-portal.org/smash/record.jsf?pid=diva2:901416 Acute Myeloid Leukemia in Adolescents and Young Adults Treated in Pediatric and Adult Departments... adolescents and young adultsacute myeloid leukemia https://boris-portal.unibe.ch/entities/publication/feb40b99-3b20-4b4e-9dfc-0e18e3a81647 Reducing FASN expression sensitizes acute myeloid leukemia cells to differentiation therapy. Fatty acid synthase (FASN) is the only human lipogenic enzyme available for de novo fatty acid synthesis and is often highly expressed in cancer cells. We... acute myeloid leukemiareducingfasnexpression https://fast.wistia.net/embed/iframe/upry7v8hpn?autoplay=true Acute Myeloid Leukemia (AML)_ Utilizing Single-Cell Multi-Omics to Uncover its Evolution and... acute myeloid leukemia https://www.cancer.org/cancer/types/acute-myeloid-leukemia/treating/radiation-therapy.html Radiation Therapy for Acute Myeloid Leukemia (AML) | American Cancer Society Radiation therapy is a treatment that uses high-energy rays or particles to destroy acute myeloid leukemia cells. Learn more here. acute myeloid leukemiaradiation therapyamlamericancancer https://www.globenewswire.com/news-release/2024/06/17/2899698/0/en/Acute-Myeloid-Leukemia-is-on-the-Rise-as-Biotechs-Race-to-Develop-Groundbreaking-Therapies.html Acute Myeloid Leukemia is on the Rise as Biotechs Race to PALM BEACH, Fla., June 17, 2024 (GLOBE NEWSWIRE) -- FN Media Group News Commentary - Acute Myeloid Leukemia (AML) is a type of cancer that affects the... acute myeloid leukemiaon the rise https://foodsystems.uw.edu/project/nutrition-support-of-an-acute-myeloid-leukemia-patient/ Nutrition Support of an Acute Myeloid Leukemia Patient | Food Systems, Nutrition, and Health School of Public Health acute myeloid leukemianutrition support https://docs.google.com/spreadsheets/d/1_KyfeZNsepIxSU0Nzw5Mi8mk1PiKCWlSBjatw0AECQ0/edit Acute Myeloid Leukemia - Google Sheets acute myeloid leukemiagooglesheets https://clarivate.com/life-sciences-healthcare/report/nrlfon0006-2017-biopharma-acute-myeloid-leukemia-niche-rare-disease-landscape-forecast-us-eu5-2017/ Acute Myeloid Leukemia | Niche & Rare Disease Landscape & Forecast | US/EU5 | 2017 | Clarivate Acute myeloid leukemia is the most common form of acute leukemia in adults. Its incidence in the major pharmaceutical markets under study is increasing,... acute myeloid leukemiarare disease https://news.med.virginia.edu/research/uva-research-leads-to-new-drug-for-deadliest-blood-cancer/attachment/acute-myeloid-leukemia-illustration/ Acute myeloid leukemia, illustration - Medicine in Motion News Dec 1, 2025 - Acute myeloid leukemia (AML), illustration. This cancer affects the myeloid tissue (bone marrow), specifically the white blood cell precursors (myeloblasts)... acute myeloid leukemiain motionillustrationmedicinenews https://www.cancer.org/cancer/types/acute-myeloid-leukemia/about/key-statistics.html Key Statistics for Acute Myeloid Leukemia (AML) | American Cancer Society The American Cancer Society's most recent estimates and statistics for acute myeloid leukemia in the United States are located here. acute myeloid leukemiakey statisticsamlamericancancer https://research.monash.edu/en/publications/clinicopathological-aspects-of-therapy-related-acute-myeloid-leuk/ Clinicopathological aspects of therapy-related acute myeloid leukemia and myelodysplastic syndrome... acute myeloid leukemiaaspectstherapyrelated https://pubmed.ncbi.nlm.nih.gov/40829168/ Proteomic subtypes enrich current acute myeloid leukemia nomenclature and reflect intrinsic... Acute myeloid leukemia (AML) is a highly heterogeneous hematological malignancy that increasingly affects the older population, with its posttranscriptional... acute myeloid leukemiaproteomicsubtypesenrichcurrent https://pubmed.ncbi.nlm.nih.gov/35356209/ Daemonorops draco Blume Induces Apoptosis Against Acute Myeloid Leukemia Cells via Regulation of... acute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/19509382/ Allogeneic stem cell transplantation for acute myeloid leukemia in first complete remission:... Compared with nonallogeneic SCT therapies, allogeneic SCT has significant RFS and overall survival benefit for intermediate- and poor-risk AML but not for... stem cell transplantationacute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/35678031/ Characteristics and outcome of patients with acute myeloid leukemia and trisomy 4 We retrospectively studied 125 patients with acute myeloid leukemia and trisomy 4 (median age at diagnosis, 58 years; range, 16-77 years) treated between 2000... acute myeloid leukemiacharacteristicsoutcomepatients https://umu.diva-portal.org/smash/record.jsf?faces-redirect=true&language=no&searchType=SIMPLE&query=&af=%5B%5D&aq=%5B%5B%5D%5D&aq2=%5B%5B%5D%5D&aqe=%5B%5D&pid=diva2%3A901416&noOfRows=50&sortOrder=author_sort_asc&sortOrder2=title_sort_asc&onlyFullText=false&sf=all Acute Myeloid Leukemia in Adolescents and Young Adults Treated in Pediatric and Adult Departments... adolescents and young adultsacute myeloid leukemia https://portal.fis.tum.de/en/publications/gemtuzumab-ozogamicin-in-npm1-mutated-acute-myeloid-leukemia-earl/fingerprints/ Gemtuzumab ozogamicin in NPM1-mutated acute myeloid leukemia: Early results from the prospective... acute myeloid leukemia https://scholars.lib.ntu.edu.tw/entities/project/7467db8c-c749-42bd-8258-09990636feb0 Hypermetylation of Multiple Suppressor Gene p15INK4B in Acute Myeloid Leukemia and Its Aapplication... acute myeloid leukemia https://portal.research.lu.se/sv/projects/investigating-downstream-molecular-pathways-of-flt3-in-acute-myel/ Investigating Downstream Molecular Pathways of FLT3 in Acute Myeloid Leukemia: Unraveling Molecular... acute myeloid leukemiainvestigatingdownstreammolecularpathways https://ecommons.cornell.edu/entities/publication/44797b91-5d89-45b9-8ca7-fbd446a884ec A case of acute myeloid leukemia in an adult Golden Retriever This paper will discuss the case of a 9 year old male castrated Golden Retriever which presented to the oncology service on 7/12/04 with a referral for... acute myeloid leukemiaan adultcase https://pmc.ncbi.nlm.nih.gov/articles/PMC3983612/ Preclinical targeting of human acute myeloid leukemia and myeloablation using chimeric antigen... Targeting of CD123 via CAR-engineered T cells results in rejection of human AML and myeloablation in mouse models. acute myeloid leukemia https://pure.psu.edu/en/publications/nonbiological-factors-affecting-survival-in-younger-patients-with/ Nonbiological factors affecting survival in younger patients with acute myeloid leukemia - Penn... acute myeloid leukemia https://scholars.lib.ntu.edu.tw/entities/project/1fe02c35-b5eb-4bd3-b454-d54c78788277 Bone Marrow Angiogenesis in Acute Myeloid Leukemia---Evaluated by Dynamic Contrast Enhanced MR... acute myeloid leukemia https://news.weill.cornell.edu/news/2021/01/new-maintenance-treatment-for-acute-myeloid-leukemia-prolongs-the-lives-of-patients New Maintenance Treatment for Acute Myeloid Leukemia Prolongs the Lives of Patients | Newsroom |... Patients with acute myeloid leukemia that has gone into remission following initial chemotherapy remain in remission longer and have improved overall survival... acute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/32560251/ Targeting Pharmacokinetic Drug Resistance in Acute Myeloid Leukemia Cells with CDK4/6 Inhibitors Pharmacotherapy of acute myeloid leukemia (AML) remains challenging, and the disease has one of the lowest curability rates among hematological malignancies.... acute myeloid leukemia https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Causes.aspx Acute Myeloid Leukemia Causes Jun 10, 2023 - Acute myeloid leukaemia (AML) starts when the DNA and genes in the stem cells of the bone marrow undergo change known as genetic mutation. This leads to... acute myeloid leukemiacauses https://www.mdpi.com/2077-0383/11/1/253 Prevention and Treatment of Acute Myeloid Leukemia Relapse after Hematopoietic Stem Cell... Allogeneic hematopoietic stem cell transplantation (HSCT) for high-risk acute myeloid leukemia (AML) represents the only curative option. Progress has been... prevention and treatmentacute myeloid leukemia https://www.biochem.mpg.de/proteogenomics-identifies-novel-acute-myeloid-leukemia-subtypes Proteogenomics identifies novel acute myeloid leukemia subtypes | Max Planck Institute of... Researchers at the MPI of Biochemistry, together with collaborating partners, have discovered the first proteomic subtype of an aggressive blood cancer known... acute myeloid leukemiamax planck instituteidentifiesnovel https://scholars.lib.ntu.edu.tw/entities/publication/a6c4689f-4ad1-4445-8c18-1abe4b23b8f9 Improved Treatment Results for Childhood Acute Myeloid Leukemia in Taiwan To improve treatment results for children with de novo acute myeloid leukemia (AML), we introduced a novel protocol, Taiwan Pediatric Oncology Group-AML-97A,... acute myeloid leukemiatreatment resultsimprovedchildhoodtaiwan https://pubmed.ncbi.nlm.nih.gov/39936576/ Acute Myeloid Leukemia: 2025 Update on Diagnosis, Risk-Stratification, and Management The availability of 12 newly approved agents has been welcomed; however, optimal strategies incorporating newer agents into therapeutic algorithms are debated.... acute myeloid leukemiarisk stratificationupdate https://www.cancer.org/cancer/types/acute-myeloid-leukemia/causes-risks-prevention/risk-factors.html Risk Factors for Acute Myeloid Leukemia (AML) | American Cancer Society | American Cancer Society Certain risk factors may increase your chance of developing acute myeloid leukemia. This guide will help you learn about possible causes. acute myeloid leukemiarisk factorsamlamericancancer https://portal.fis.tum.de/de/publications/gemtuzumab-ozogamicin-in-npm1-mutated-acute-myeloid-leukemia-earl/ Gemtuzumab ozogamicin in NPM1-mutated acute myeloid leukemia: Early results from the prospective... acute myeloid leukemia https://pubmed.ncbi.nlm.nih.gov/28137827/ S100A9 induces differentiation of acute myeloid leukemia cells through TLR4 S100A8 and S100A9 are calcium-binding proteins predominantly expressed by neutrophils and monocytes and play key roles in both normal and pathological... acute myeloid leukemiadifferentiationcells https://pmc.ncbi.nlm.nih.gov/articles/PMC12523351/ T-Cell Engagers in Acute Myeloid Leukemia: Molecular Targets, Structure, and Therapeutic Challenges... Acute myeloid leukemia remains difficult to treat due to its high relapse rates after standard therapies. T-cell engagers are a promising new approach that... acute myeloid leukemia https://researchconnect.buffalo.edu/en/publications/dexrazoxane-for-cardioprotection-in-older-adults-with-acute-myelo/ Dexrazoxane for cardioprotection in older adults with acute myeloid leukemia - SUNY University at... acute myeloid leukemia https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCT03836209&r=1 Gilteritinib vs Midostaurin in FLT3 Mutated Acute Myeloid Leukemia - NCI Gilteritinib vs Midostaurin in FLT3 Mutated Acute Myeloid Leukemia acute myeloid leukemiavsmidostaurinmutatednci https://pubmed.ncbi.nlm.nih.gov/8609707/ Epipodophyllotoxin-related acute myeloid leukemia: a study of 35 cases To define better the risk of epipodophyllotoxin-related acute myeloid leukemia (AML) after extended follow-up and to assess responses to intensive salvage... acute myeloid leukemiarelatedstudycases https://experts.arizona.edu/en/publications/translating-genetic-questions-into-clinical-answers-in-acute-myel/ Translating genetic questions into clinical answers in acute myeloid leukemia - University of... acute myeloid leukemia https://www.semanticscholar.org/topic/Acute-Myeloid-Leukemia-Arising-from-Previous/258715 Acute Myeloid Leukemia Arising from Previous Myelodysplastic Syndrome | Semantic Scholar An acute myeloid leukemia developing in patients with a prior history of myelodysplastic syndrome. acute myeloid leukemiamyelodysplastic syndromearisingprevioussemantic https://english.cas.cn/newsroom/research-news/202604/t20260410_1155637.shtml New DNMT1 Inhibitor Overcomes HMA Resistance in Acute Myeloid Leukemia----Chinese Academy of... acute myeloid leukemia https://pure.psu.edu/en/publications/successful-treatment-of-relapsed-pediatric-acute-myeloid-leukemia/ Successful Treatment of Relapsed Pediatric Acute Myeloid Leukemia Presenting as Central Nervous... acute myeloid leukemia https://www.news-medical.net/health/Acute-Myeloid-Leukemia-Diagnosis.aspx Acute Myeloid Leukemia Diagnosis Jun 10, 2023 - If a patients presents with the symptoms of acute myeloid leukemia a battery of tests are ordered. The tests used to diagnose AML include the following. acute myeloid leukemiadiagnosis https://pmc.ncbi.nlm.nih.gov/articles/PMC6207763/ Cortisol facilitates the immune escape of human acute myeloid leukemia cells by inducing... acute myeloid leukemia https://vivo.colorado.edu/display/pubid_277615 IncRNA requirements for mouse acute myeloid leukemia and normal differentiation | CU Experts | CU... acute myeloid leukemia https://www.frontiersin.org/journals/oncology/articles/10.3389/fonc.2021.748250/full Frontiers | Biomarkers in Acute Myeloid Leukemia: Leveraging Next Generation Sequencing Data for... Next generation sequencing (NGS) is routinely used for mutation profiling of acute myeloid leukemia (AML). The extensive application of NGS in hematologic ma... acute myeloid leukemianext generation sequencing https://medlineplus.gov/genetics/condition/familial-acute-myeloid-leukemia-with-mutated-cebpa/ Familial acute myeloid leukemia with mutated CEBPA: MedlinePlus Genetics Familial acute myeloid leukemia with mutated CEBPA is one form of a cancer of the blood-forming tissue ( bone marrow ) called acute myeloid leukemia. Explore... acute myeloid leukemiafamilialmutatedmedlineplusgenetics https://pubmed.ncbi.nlm.nih.gov/36149183/ Acute myeloid leukemia and myelofibrosis: Simultaneous transformation of essential thrombocythemia... Essential thrombocytosis (ET) is usually an indolent disease but can uncommonly evolve into acute myeloid leukemia (AML) with a grim prognosis of 2-7 months.... acute myeloid leukemiamyelofibrosissimultaneoustransformationessential https://pubmed.ncbi.nlm.nih.gov/27373815/ Prevalence and Clinical Significance of FLT3 Mutation Status in Acute Myeloid Leukemia Patients: A... Prevalence of FLT3-ITD mutation in AML was present in a proportion comparable to other populations and, when present, was associated with a very poor prognosis. https://www.cancer.gov/research/participate/clinical-trials-search/v?id=NCI-2024-01721&r=1 Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable... Revumenib and Venetoclax for the Treatment of Patients with Acute Myeloid Leukemia with Measurable Residual Disease https://pubmed.ncbi.nlm.nih.gov/36130297/ Genomic profiling for clinical decision making in myeloid neoplasms and acute leukemia Myeloid neoplasms and acute leukemias derive from the clonal expansion of hematopoietic cells driven by somatic gene mutations. Although assessment of... clinical decision makinggenomic profiling https://pubmed.ncbi.nlm.nih.gov/38632314/ KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia KRAS G12 mutations as adverse prognostic factors in KMT2A-rearranged acute myeloid leukemia https://adisinsight.springer.com/trials/700308326?error=cookies_not_supported&code=5303b7d7-3418-4513-86b1-677c2ec4e767 A phase 1 clinical trial of TK-216 in patients with relapsed acute myeloid leukemia (AML) -... This study will evaluate TK-216 in patients with relapsed acute myeloid leukemia (AML). https://adisinsight.springer.com/trials/700392486?error=cookies_not_supported&code=df99c4de-43a6-4741-b287-9a3665d27da7 To evaluate a novel immunotherapy for acute myeloid leukemia (AML) that uses universal killer T... This study is to evaluate a novel immunotherapy for acute myeloid leukemia (AML) that uses universal killer T cells derived from iPS cells. https://pubmed.ncbi.nlm.nih.gov/21030981/ PHF6 mutations in adult acute myeloid leukemia Loss of function mutations and deletions encompassing the plant homeodomain finger 6 (PHF6) gene are present in about 20% of T-cell acute lymphoblastic... mutationsadultacutemyeloidleukemia https://cordis.europa.eu/project/id/101153517 SMART-AML: Shaping Marrow Adiposity to Redefine Treatment in Acute Myeloid Leukemia | SMART-AML |... Acute Myeloid Leukemia (AML) is an aggressive hematologic malignancy characterized by the uncontrolled proliferation of myeloid cells, which hijack the bone... https://pure.psu.edu/en/publications/healthcare-costs-and-utilization-for-patients-age-50-to-64-years-/ Healthcare Costs and Utilization for Patients Age 50 to 64 Years with Acute Myeloid Leukemia... https://hsbiblio.uni-tuebingen.de/xmlui/handle/10900/124575 DNAM-1/CD226 is functionally expressed on acute myeloid leukemia (AML) cells and is associated with... https://pmc.ncbi.nlm.nih.gov/articles/PMC8997036/ Use of Venetoclax in Patients with Relapsed or Refractory Acute Myeloid Leukemia: The PETHEMA... The use of venetoclax combined with hypomethylating agents or low-dose cytarabine in patients with newly diagnosed acute myeloid leukemia unfit for intensive... https://pmc.ncbi.nlm.nih.gov/articles/PMC27754/ t(11;22)(q23;q11.2) in acute myeloid leukemia of infant twins fuses MLL with hCDCrel, a cell... We examined the MLL genomic translocation breakpoint in acute myeloid leukemia of infant twins. Southern blot analysis in both cases showed two identical MLL... https://collaborate.princeton.edu/en/publications/genomic-and-epigenomic-landscapes-of-adult-de-novo-acute-myeloid-/ Genomic and epigenomic landscapes of adult de novo acute myeloid leukemia - Princeton University https://scholars.uky.edu/es/publications/discovery-of-a-diaminopyrimidine-flt3-inhibitor-active-against-ac/ Discovery of a Diaminopyrimidine FLT3 Inhibitor Active against Acute Myeloid Leukemia - of adiscovery https://refubium.fu-berlin.de/handle/fub188/15028?locale-attribute=en Refubium - Unrelated donor versus matched sibling donor in adults with acute myeloid leukemia in... https://open.bu.edu/items/c94a9e44-12db-4069-84e9-0a691d6606b5 Factors associated with intensity of end-of-life care for patients with acute myeloid leukemia https://pmc.ncbi.nlm.nih.gov/articles/PMC7072334/ Harnessing T Cells to Target Pediatric Acute Myeloid Leukemia: CARs, BiTEs, and Beyond - PMC Outcomes for pediatric patients with acute myeloid leukemia (AML) remain poor, highlighting the need for improved targeted therapies. Building on the success...