https://www.pega.com/products/platform/ai-app-development
Build Fast with AI-Powered App Development | Pega
Jan 15, 2025 - Learn how Pega can help you seamlessly create customizable workflows and enterprise-grade apps that move your business forward.
ai powered appbuildfastdevelopmentpega
https://www.zoho.com/flow/?src=zflow-articles
Zoho Flow | AI-powered app integration and workflow automation platform
Zoho Flow is an AI-powered integration platform that lets you automate your workflows regardless of your role or business.
ai powered appzoho flowworkflow automationintegrationplatform
https://devready.ai/
Devready.Ai | AI-Powered App Planning for Non-Tech Founders
ai powered appplanning fornon techfounders
https://www.analyticsinsight.net/ampstories/artificial-intelligence/c3-introduces-ai-powered-app-for-government-programs
C3 Introduces AI-Powered App for Government Programs
Discover C3's innovative AI-powered app for government programs, revolutionizing efficiency and accessibility in public services.
ai powered appfor governmentc3introducesprograms
https://steelcorr.com/
Home - AI Powered app & Non-Sparking Tools - SteelCorr
ai powered appnon sparking toolssteelcorr
https://www.idrumtune.com/
Drum Tuning | AI Powered App For Accurate Drum Sound | iDrumTune
Dec 23, 2025 - iDrumTune Pro. The art and science of drum tuning. Achieve your perfect drum sound. The original and most accurate drum tuner available.
ai powered appdrum tuningaccuratesound
https://www.cqlsys.com/
AI-Powered App Development, Cloud Solutions & Digital Transformation | CQLsys
CQLsys enables enterprises with AI-powered app development, secure cloud solutions, and digital transformation to maximize performance, efficiency, innovation,...
ai powered appdevelopment clouddigital transformationsolutions
https://appcrunk.com/
Appcrunk Technologies | AI-Powered App Development Company
Appcrunk Technologies is a top AI-powered mobile app and web development company delivering scalable, secure and high-performance digital solutions for...
ai powered apptechnologiesdevelopmentcompany
https://www.cityam.com/miq-acquires-rocket-lab-to-accelerate-ai-powered-app-growth-globally/
MiQ Acquires Rocket Lab to Accelerate AI-Powered App Growth Globally
Apr 8, 2026 - Deal brings in-app growth and total-market reach together in one unified advertising solution
ai powered approcket labto acceleratemiqacquires
https://www.appforcestudio.com/
AppForceStudio - Next-Gen AI-Powered App Creation Platform
AppForceStudio: AI app builder. Streamline your workflow from design to deployment in our app and UI design creation platform.
ai powered appnext gencreationplatform
https://www.zscaler.com/fr/blogs/product-insights/eliminate-lateral-movement-attacks-ai-powered-app-segmentation-and
Eliminate Lateral Attacks with AI-Powered App Segmentation
Based on the analysis of app traffic and user flow AI-Powered App Segmentation can intelligently segment apps and recommend policies based on user groups.
ai powered appeliminatelateralattackssegmentation
https://vidonary.com/
Vidonary – AI-powered app for fast video planning, recording, editing, and publishing
ai powered app
https://www.shipbook.io/
AI-Powered App Logging Platform | Shipbook
ai powered apploggingplatform
https://cqlsys.com/
AI-Powered App Development, Cloud Solutions & Digital Transformation | CQLsys
CQLsys enables enterprises with AI-powered app development, secure cloud solutions, and digital transformation to maximize performance, efficiency, innovation,...
ai powered appdevelopment clouddigital transformationsolutions
https://www.khaleejtimes.com/uae/dubai-free-ai-powered-legal-app
Dubai: Get legal answers globally with free AI-powered app | Khaleej Times
Born in Romania, Elena began her career as a media personality before moving to Dubai in 2018, where she first ventured into real estate and later opened a law...
ai powered applegal answers
https://consciouswebdesign.com/
Conscious Web Design | AI-Powered Web & App Development | 33+ Years
web design aiapp developmentconsciouspowered33
https://mynextidea.com/
Get Started on Your Next Idea - AI-Powered App Ideas
Get inspiration for a name, features, marketing ideas, and check the competition with AI-powered insights.
ai powered appget startedyour nextidea
https://dang.ai/tool/ai-powered-app-builder-prismsai
AI Powered App Builder - PrismsAI - What happened to prisms.ai? Why Did PrismsAI Shut Down?
Create AI-powered apps effortlessly with Prisms AI, the ultimate no-code platform. No coding required. PrismsAI is a AI Powered App Builder featured on...
ai powered appwhat happened to
https://habitudesports.ai/
AI-Powered App Helping Gymnasts Perfect Skills & Elevate Well-Being
The Habitude Sports AI Platform empowers gymnasts, coaches, clubs and parents by improving skills and routines through video analysis, personalized...
ai powered apphelpinggymnastsperfectskills
https://localizex.app/
LocalizeX - AI Powered app Localization for Apple Developers
LocalizeX is a macOS app for accurate translations with OpenAI. Localize Apple apps and App Store Connect metadata, maintaining format and special characters.
ai powered appfor applelocalizationdevelopers
https://nandbox.com/
AI-Powered App Builder – Build Native Apps, No Code | nandbox
ai powered appnative appsno codebuilder
https://kotlinlang.org/docs/kotlin-ai-apps-development-overview.html
Kotlin for AI-powered app development | Kotlin Documentation
ai powered appkotlindevelopmentdocumentation
https://www.zoho.com/flow/?src=need-for-integration-platform-article
Zoho Flow | AI-powered app integration and workflow automation platform
Zoho Flow is an AI-powered integration platform that lets you automate your workflows regardless of your role or business.
ai powered appzoho flowworkflow automationintegrationplatform
https://mega-defence.com/
MEGA Defence: AI-Powered App for Identifying Military Equipment via Image Detection
Jun 13, 2024 - MEGA Defence: Use advanced AI and image detection technology to identify military vehicles, aircraft, ships, and weapons instantly. Enhance your defense...
ai powered app
https://appforcestudio.com/
AppForceStudio - Next-Gen AI-Powered App Creation Platform
AppForceStudio: AI app builder. Streamline your workflow from design to deployment in our app and UI design creation platform.
ai powered appnext gencreationplatform
https://dianapps.com/
DianApps: AI-Powered App Development & Digital IT Solutions
ai powered appdigital itdianappsdevelopmentsolutions
https://www.coursera.org/learn/packt-code-the-future-ai-powered-app-building-with-no-code-full-stack-tool-ngyv4
AI-Powered App Building with No-Code & Full Stack | Coursera
Offered by Packt. This course features Coursera Coach! A smarter way to learn with interactive, real-time conversations that help you test ... Enroll for free.
ai powered appno codefull stackbuildingcoursera
https://elann.ai/
AI powered App for Crypto & Web3
Unleash the power of Crypto AI with Enhanced Language Oriented Neural Network
ai powered appfor cryptoweb3
https://www.instabizweb.com/
Insta Biz Web - AI-Powered Web, App & Digital Solutions
Insta Biz Web builds AI-powered websites, mobile apps, CRM systems and digital automation solutions. We help startups and businesses grow through modern...
ai powered appinstabizwebdigital
https://www.digiora.com/
AI-Powered App And Web Development Company Kerala| Digital Marketing Company India | Digiora
At Digiora we offer Web and app development and design, digital marketing services in Kochi, India. Also provide our services to clients in the USA, UK and...
ai powered appweb development companydigital marketing india
https://www.zoho.com/flow/
Zoho Flow | AI-powered app integration and workflow automation platform
Zoho Flow is an AI-powered integration platform that lets you automate your workflows regardless of your role or business.
ai powered appzoho flowworkflow automationintegrationplatform
https://slowrush.com/
Slowrush | AI-Powered App Studio
Slowrush - An independent App Studio shaping the future with Generative AI. Lisa AI and more.
ai powered appstudio
https://blazorly.dev/
Blazorly - AI-Powered App Builder
ai powered appbuilder
https://www.looksmaxxreport.com/
Maxx Report - AI Glow Up & LooksMaxx App | 15 AI-Powered Reports | Maxx Report
Get 15 AI-powered reports analyzing facial aesthetics, style transformations, color analysis, hairstyles, makeup, clothing, accessories, grooming, and more....
glow upmaxxreportaiapp
https://www.quikrai.us/
AI-powered digital marketing, CRM, app development, optimization solutions | Quikr AI
Discover AI-powered digital marketing, CRM, app development, and optimization services. Quikr AI transforms business growth with smart automation, predictive...
ai powered digital marketingcrm appdevelopmentoptimizationsolutions
https://www.v3cube.com/uber-clone/
Uber Clone - AI-Powered Taxi App Solution
Uber Clone is an AI-Enabled taxi app that connects riders with drivers. Customizable solution enables entrepreneurs to launch a ride-hailing business.
uber cloneai poweredtaxi appsolution
https://domainrank.app/
AI-Powered Domain Rank & Traffic Growth - Domain Rank App
Analyze your domain authority, track rankings, and get actionable SEO insights to boost organic traffic. Comprehensive metrics and competitor analysis.
ai powereddomain ranktraffic growthapp
https://wov.app/
Create Shopping Apps faster than ever. Powered by AI - WOV.APP
powered by aishopping appscreatefaster
https://www.codeway.co/
Codeway | Leading in AI-Powered Mobile App Development
Codeway brings cutting-edge AI to millions of users around the globe. Explore the future with Codeway.
ai poweredmobile appcodewayleadingdevelopment
https://undressappai.com/
Undress App AI - Create Deep Nude Images for FREE | Powered by 999nudes AI
Undress AI App - Create photos with the best Deepnude AI app. Undress her in seconds and create deep nude images with AI Undress technology.
undress appai createdeep nude
https://www.devlop.app/
Devlop.app | Build AI-Powered Android/iOS Apps Instantly
Build complete Android and iOS apps with just a prompt. Devlop.app turns your idea into production-ready code, preview it live, download, or generate an APK...
app buildai poweredandroid iosappsinstantly
https://classonapp.com/
Best School ERP Software India | AI-Powered | 1000+ Schools | Class ON App
India's best School ERP Software trusted by 1000+ schools across 24 states. Cloud-based, CBSE-ready, with 4 mobile apps. Free demo available. Call now!
school erp softwareindia ai
https://auraweb.digital/
Auraweb Digital | AI-Powered Web/App & Cloud Solutions
Transform workflows with Auraweb Digital’s AI automation, custom web/mobile apps, and cloud solutions. Drive growth.
digital aiweb appaurawebpoweredcloud
https://endsofttech.com/
Custom Web App Development & AI-Powered Digital Solutions | Endsofttech
Endsofttech delivers custom web app development, AI-driven automation, SEO, SMO, SMM, e-commerce solutions, and full web maintenance. Build smarter, scalable...
custom web app developmentai powereddigital solutions
https://aipdf.ai/
aiPDF - Your AI-Powered PDF Chat App
aiPDF is an AI-powered tool that transforms your PDF experience. Summarize, extract insights, and chat with any PDF, web article, Youtube video, or podcast.
ai poweredpdf chataipdfapp