Robuta

https://www.wikidata.org/wiki/Q30090163 Isolation of two cDNAs encoding zinc finger proteins which bind to the alpha 1-antitrypsin promoter... scientific article published in January 1991 https://discovery.fiu.edu/display/pub287060 Alpha-1 antitrypsin deficiency and pregnancy complications and birth outcomes: A population-based... pregnancy complications https://profiles.wustl.edu/en/publications/transfer-of-the-human-alphasub1sub-antitrypsin-gene-into-pulmonar/fingerprints/ Transfer of the human alphasub1/sub-antitrypsin gene into pulmonary macrophages in vivo -... https://pubmed.ncbi.nlm.nih.gov/24800593/ Alpha-1 antitrypsin deficiency and spontaneous pneumothorax: possible causal relationship Preliminary data confirm the clinical importance of alpha-1 antitrypsin deficiency phenotypes in patients with spontaneous pneumothorax and the need to screen... spontaneous pneumothoraxalphaantitrypsindeficiencypossible https://expertmarketresearch-emr.blogspot.com/2022/08/global-alpha-1-antitrypsin-deficiency.html Global Alpha-1 Antitrypsin Deficiency (AATD) Treatment Market Growth to be Driven by the Growing... https://medlineplus.gov/genetics/condition/alpha-1-antitrypsin-deficiency/ Alpha-1 antitrypsin deficiency: MedlinePlus Genetics Alpha-1 antitrypsin deficiency is an inherited disorder that may cause lung disease and liver disease. Explore symptoms, inheritance, genetics of this... alphaantitrypsindeficiencymedlineplusgenetics https://www.50yearsofalpha1.org/ Alpha-1 Antitrypsin Deficiency - 50th Anniversary 2013 marks the fiftieth anniversary of the publication of the first paper on the link between emphysema and a deficiency in the protein alpha-1 antitrypsin. alphaantitrypsindeficiencyanniversary https://gpe.wikipedia.org/wiki/Alpha-1_antitrypsin_deficiency Alpha-1 antitrypsin deficiency - Wikipedia alphaantitrypsindeficiencywikipedia https://geneticmedicine.weill.cornell.edu/publications/evaluation-risk-alpha-1-antitrypsin-genotype-sz-synthetic-oligonucleotide-gene-probes Evaluation of "at risk" alpha 1-antitrypsin genotype SZ with synthetic at riskevaluationalpha https://www.uncoveralpha1.com/ What Is Alpha-1 Antitrypsin Deficiency (AATD)? | uncover alpha-1 Learn about alpha-1 antitrypsin deficiency (AATD), a genetic condition that affects the lungs. Explore testing, management, and patient support resources. what is alphaantitrypsindeficiencyaatduncover https://pubmed.ncbi.nlm.nih.gov/18766166/?dopt=Abstract Alpha-1 antitrypsin (alpha1-AT) plasma levels in lung, prostate and breast cancer patients These data demonstrated that alpha1-AT plasma levels might be an alarming factor to be considered in the diagnosis as well as in the follow up of cancer cases. https://portal.research.lu.se/sv/publications/decline-in-fev1-related-to-smoking-status-in-individuals-with-sev/ Decline in FEV1 related to smoking status in individuals with severe alpha1-antitrypsin deficiency... https://www.ncbi.nlm.nih.gov/Structure/pdb/7AEL 7AEL: alpha 1-antitrypsin (C232S) complexed with GSK716 alphaantitrypsin https://www.frontiersin.org/journals/public-health/articles/10.3389/fpubh.2013.00019/full Frontiers | Alpha-1 Antitrypsin Reduces Severity of Pseudomonas Pneumonia in Mice and Inhibits... Nosocomial pneumonia (NP) is the third most common hospital-acquired infection and the leading cause of death due to hospital-acquired infection in the US. ... https://pubmed.ncbi.nlm.nih.gov/?term=%22alpha+1-Antitrypsin+Deficiency%22%5Bmajr%3Anoexp%5D+AND+humans%5Bmh%5D+AND+english%5Bla%5D+AND+%22last+1+Year%22+%5Bedat%5D+NOT+%28letter%5Bpt%5D+OR+case+reports%5Bpt%5D+OR+editorial%5Bpt%5D+OR+comment%5Bpt%5D%29+AND+free+full+text%5Bsb%5D+ "alpha 1-Antitrypsin Deficiency"[majr:noexp] AND humans[mh] AND english[la] AND "last 1 Year"... "alpha 1-Antitrypsin Deficiency"[majr:noexp] AND humans[mh] AND english[la] AND "last 1 Year" [edat] NOT (letter[pt] OR case reports[pt] OR editorial[pt] OR... https://pubmed.ncbi.nlm.nih.gov/39739519/ Regarding: Alpha-1 antitrypsin deficiency associated with increased risks of skin cancer, leukemia,... Regarding: Alpha-1 antitrypsin deficiency associated with increased risks of skin cancer, leukemia, and hepatic cancer: A nationwide cohort study https://scholars.duke.edu/publication/1494522 Scholars@Duke publication: Imaging in alpha-1 antitrypsin deficiency: a window into the disease. https://www.ncbi.nlm.nih.gov/Structure/pdb/8P4U 8P4U: Alpha-1-antitrypsin - Sydney variant (G192C) alphaantitrypsinsydneyvariant https://www.frontiersin.org/journals/molecular-biosciences/articles/10.3389/fmolb.2024.1485506/full Frontiers | Alpha 1-antitrypsin mitigates salt-sensitive hypertension in juvenile mice by reducing... IntroductionRecombinant alpha-1 antitrypsin (AAT) therapy has been shown to have beneficial effects to mitigate the progression of various diseases. Here, we... https://pubmed.ncbi.nlm.nih.gov/19553648/ Clinical practice. Alpha1-antitrypsin deficiency Clinical practice. Alpha1-antitrypsin deficiency clinical practiceantitrypsindeficiency https://pubmed.ncbi.nlm.nih.gov/20496303/ Alpha-1 antitrypsin deficiency: whom to test, whom to treat? Alpha-1 antitrypsin deficiency (AATD) is the major identified genetic risk factor for chronic obstructive pulmonary disease (COPD). The biochemical events... to testalphaantitrypsindeficiencytreat